Details of the Target
General Information of Target
| Target ID | LDTP11831 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras association domain-containing protein 4 (RASSF4) | |||||
| Gene Name | RASSF4 | |||||
| Gene ID | 83937 | |||||
| Synonyms |
Ras association domain-containing protein 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVLLIVKMAGR
CKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGA LTELGYNVFFVRD |
|||||
| Target Bioclass |
Other
|
|||||
| Function | Potential tumor suppressor. May act as a KRAS effector protein. May promote apoptosis and cell cycle arrest. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C145(0.00); C33(0.00) | LDD0241 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C249(1.14) | LDD0304 | [2] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [3] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Serine/threonine-protein kinase 3 (STK3) | STE Ser/Thr protein kinase family | Q13188 | |||
| Serine/threonine-protein kinase 4 (STK4) | STE Ser/Thr protein kinase family | Q13043 | |||
Other
References




