General Information of Target

Target ID LDTP11798
Target Name Caspase recruitment domain-containing protein 9 (CARD9)
Gene Name CARD9
Gene ID 64170
Synonyms
Caspase recruitment domain-containing protein 9; hCARD9
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC
VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDLQAVGGK
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Adapter protein that plays a key role in innate immune response against fungi by forming signaling complexes downstream of C-type lectin receptors. CARD9-mediated signals are essential for antifungal immunity against a subset of fungi from the phylum Ascomycota. Transduces signals in myeloid cells downstream of C-type lectin receptors CLEC7A (dectin-1), CLEC6A (dectin-2) and CLEC4E (Mincle), which detect pathogen-associated molecular pattern metabolites (PAMPs), such as fungal carbohydrates, and trigger CARD9 activation. Upon activation, CARD9 homooligomerizes to form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10 and subsequent recruitment of MALT1: this leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. CARD9 signaling in antigen-presenting cells links innate sensing of fungi to the activation of adaptive immunity and provides a cytokine milieu that induces the development and subsequent of interleukin 17-producing T helper (Th17) cells. Also involved in activation of myeloid cells via classical ITAM-associated receptors and TLR: required for TLR-mediated activation of MAPK, while it is not required for TLR-induced activation of NF-kappa-B. CARD9 can also be engaged independently of BCL10: forms a complex with RASGRF1 downstream of C-type lectin receptors, which recruits and activates HRAS, leading to ERK activation and the production of cytokines. Acts as an important regulator of the intestinal commensal fungi (mycobiota) component of the gut microbiota. Plays an essential role in antifungal immunity against dissemination of gut fungi: acts by promoting induction of antifungal IgG antibodies response in CX3CR1(+) macrophages to confer protection against disseminated C.albicans or C.auris infection. Also mediates immunity against other pathogens, such as certain bacteria, viruses and parasites; CARD9 signaling is however redundant with other innate immune responses. In response to L.monocytogenes infection, required for the production of inflammatory cytokines activated by intracellular peptidoglycan: acts by connecting NOD2 recognition of peptidoglycan to downstream activation of MAP kinases (MAPK) without activating NF-kappa-B.
Uniprot ID
Q9H257
Ensemble ID
ENST00000371732.10
HGNC ID
HGNC:16391

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A498 SNV: p.A313S .
AN3CA SNV: p.A198V .
CORL23 SNV: p.E394K .
EOL1 SNV: p.Q436R DBIA    Probe Info 
HCT15 SNV: p.I361T .
HEC1 SNV: p.Q398P .
HEC1B SNV: p.Q398P .
HUH7 SNV: p.I355V .
IGROV1 SNV: p.A507T .
IM95 Deletion: p.K38RfsTer3 .
LNCaP clone FGC Deletion: p.E519RfsTer64 .
MCC26 SNV: p.E167K .
MEWO SNV: p.E320K .
NCIH1155 SNV: p.R57H .
NCIH2286 SNV: p.D451V .
OVISE SNV: p.Q512Ter .
TOV21G SNV: p.E377Ter; p.Q436K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C454(1.72)  LDD3333  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 769-P C168(1.23); C454(2.32)  LDD2246  [1]
 LDCM0023  KB03 769-P C454(2.01)  LDD2663  [1]
 LDCM0024  KB05 MOLM-13 C454(1.72)  LDD3333  [1]

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840