Details of the Target
General Information of Target
| Target ID | LDTP11783 | |||||
|---|---|---|---|---|---|---|
| Target Name | Epsin-3 (EPN3) | |||||
| Gene Name | EPN3 | |||||
| Gene ID | 55040 | |||||
| Synonyms |
Epsin-3; EPS-15-interacting protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKE
FLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQ RHYDEDSAIGPRSPYGFRHGASVNYDDY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Epsin family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y186(9.73) | LDD3495 | [1] | |
|
DBIA Probe Info |
![]() |
C96(1.95) | LDD3320 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y17(4.56) | LDD2237 | [3] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [4] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [5] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [6] | |
|
HHS-475 Probe Info |
![]() |
Y17(0.59) | LDD2238 | [3] | |
|
HHS-482 Probe Info |
![]() |
Y17(0.58) | LDD2239 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [6] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [6] |
| LDCM0022 | KB02 | BRX211 | C96(1.95) | LDD2268 | [2] |
| LDCM0023 | KB03 | ABC-1 | C96(2.51) | LDD2679 | [2] |
| LDCM0024 | KB05 | RVH421 | C96(1.95) | LDD3320 | [2] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [6] |
References









