Details of the Target
General Information of Target
| Target ID | LDTP11776 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dual specificity protein phosphatase 15 (DUSP15) | |||||
| Gene Name | DUSP15 | |||||
| Gene ID | 128853 | |||||
| Synonyms |
C20orf57; VHY; Dual specificity protein phosphatase 15; EC 3.1.3.16; EC 3.1.3.48; VH1-related member Y; Vaccinia virus VH1-related dual-specific protein phosphatase Y |
|||||
| 3D Structure | ||||||
| Sequence |
MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPT
PKPKIELPERFRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRS CKGAFARELCWPKQGVH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
|
|||||
| Subcellular location |
Cytoplasm; Cytoplasmic side; Lipid-anchor; Cell membrane
|
|||||
| Function |
May dephosphorylate MAPK13, ATF2, ERBB3, PDGFRB and SNX6.; [Isoform 3]: May play a role in the regulation of oligodendrocyte differentiation. May play a role in the regulation of myelin formation. Involved in the regulation of Erk1/2 phosphorylation in Schwann cells; the signaling may be linked to the regulation of myelination.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C69(2.36) | LDD3411 | [1] | |
Competitor(s) Related to This Target