Details of the Target
General Information of Target
| Target ID | LDTP11772 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial glutamate carrier 2 (SLC25A18) | |||||
| Gene Name | SLC25A18 | |||||
| Gene ID | 83733 | |||||
| Synonyms |
GC2; Mitochondrial glutamate carrier 2; GC-2; Glutamate/H(+) symporter 2; Solute carrier family 25 member 18 |
|||||
| 3D Structure | ||||||
| Sequence |
MAAAGAFRLRRAASALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVG
TGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTI KNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Mitochondrial carrier (TC 2.A.29) family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function | Responsible for the transport of glutamate from the cytosol into the mitochondrial matrix with the concomitant import of a proton (symport system). | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
|
DBIA Probe Info |
![]() |
C25(1.71) | LDD3442 | [2] | |
|
SF Probe Info |
![]() |
K82(0.00); K79(0.00) | LDD0028 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC) | . | Q9HD26 | |||
Other
References



