Details of the Target

General Information of Target

Target ID LDTP11755
Target Name Syntenin-2 (SDCBP2)
Gene Name SDCBP2
Gene ID 27111
Synonyms
SITAC18; Syntenin-2; Similar to TACIP18; SITAC; Syndecan-binding protein 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEE
ELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLD
INTNTYTSQDLKSALAKFKEGAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIET
DMQIMVRLINKFNSSSSSLEEKIAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLNSTEP
LVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATEQPLTAKKKVLFALCSLLRHF
PYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEAELTQEMSPEK
LQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR
TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR
Target Bioclass
Other
Subcellular location
Cytoplasm
Function Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival.
Uniprot ID
Q9H190
Ensemble ID
ENST00000339987.7
HGNC ID
HGNC:15756

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.A222T .
LNCaP clone FGC SNV: p.A48S; p.E51Ter .
SNU1196 SNV: p.G92R DBIA    Probe Info 
SNU449 SNV: p.M27I .
TCCSUP SNV: p.Y269Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C27(1.62)  LDD3439  [1]
IA-alkyne
 Probe Info  		C112(0.00); C160(0.00); C233(0.00)  LDD0162  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 BRX142 C27(1.11)  LDD2267  [1]
 LDCM0023  KB03 BRX330 C27(1.34)  LDD2688  [1]
 LDCM0024  KB05 SNU-1196 C27(1.62)  LDD3439  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Platelet-activating factor acetylhydrolase IB subunit alpha1 (PAFAH1B3) GDSL lipolytic enzyme family Q15102
Cryptochrome-2 (CRY2) DNA photolyase class-1 family Q49AN0
ADP-ribosylation factor 4 (ARF4) Arf family P18085
Tryptophan 2,3-dioxygenase (TDO2) Tryptophan 2,3-dioxygenase family P48775
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Transmembrane 4 L6 family member 1 (TM4SF1) L6 tetraspanin family P30408
RNA-binding protein with serine-rich domain 1 (RNPS1) Splicing factor SR family Q15287
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cell growth-regulating nucleolar protein (LYAR) . Q9NX58
Zinc finger protein 581 (ZNF581) . Q9P0T4
Other
Click To Hide/Show 39 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cancer/testis antigen family 45 member A1 (CT45A1) CT45 family Q5HYN5
Cancer/testis antigen family 45 member A10 (CT45A10) CT45 family P0DMU9
Cancer/testis antigen family 45 member A3 (CT45A3) CT45 family Q8NHU0
Probable RNA-binding protein EIF1AD (EIF1AD) EIF1AD family Q8N9N8
Large ribosomal subunit protein eL22 (RPL22) Eukaryotic ribosomal protein eL22 family P35268
Ribosomal protein eL22-like (RPL22L1) Eukaryotic ribosomal protein eL22 family Q6P5R6
Small ribosomal subunit protein eS32 (RPL41) Eukaryotic ribosomal protein eL41 family P62945
Protein FAM13C (FAM13C) FAM13 family Q8NE31
Protein FAM133A (FAM133A) FAM133 family Q8N9E0
Protein FAM9B (FAM9B) FAM9 family Q8IZU0
Heat shock factor-binding protein 1 (HSBP1) HSBP1 family O75506
Small ribosomal subunit protein mS37 (CHCHD1) Mitochondrion-specific ribosomal protein mS37 family Q96BP2
NFU1 iron-sulfur cluster scaffold homolog, mitochondrial (NFU1) NifU family Q9UMS0
Nucleolar protein 56 (NOP56) NOP5/NOP56 family O00567
Spermatid nuclear transition protein 1 (TNP1) Nuclear transition protein 1 family P09430
Nucleoplasmin-2 (NPM2) Nucleoplasmin family Q86SE8
Protamine-2 (PRM2) Protamine P2 family P04554
Pre-mRNA-splicing factor 38A (PRPF38A) PRP38 family Q8NAV1
Meiotic recombination protein DMC1/LIM15 homolog (DMC1) RecA family Q14565
Synaptotagmin-17 (SYT17) Synaptotagmin family Q9BSW7
T-complex protein 11-like protein 1 (TCP11L1) TCP11 family Q9NUJ3
TRAF-interacting protein with FHA domain-containing protein A (TIFA) TIFA family Q96CG3
Vacuolar protein-sorting-associated protein 25 (VPS25) VPS25 family Q9BRG1
A-kinase anchor protein 17A (AKAP17A) . Q02040
Arf-GAP with dual PH domain-containing protein 1 (ADAP1) . O75689
Cysteine-rich C-terminal protein 1 (CRCT1) . Q9UGL9
F-box only protein 28 (FBXO28) . Q9NVF7
Galectin-2 (LGALS2) . P05162
Multiple myeloma tumor-associated protein 2 (MMTAG2) . Q9BU76
Placental protein 13-like (LGALS14) . Q8TCE9
Polyhomeotic-like protein 1 (PHC1) . P78364
Proline-rich protein 13 (PRR13) . Q9NZ81
Protein SREK1IP1 (SREK1IP1) . Q8N9Q2
Syntenin-2 (SDCBP2) . Q9H190
U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 (ZRSR2) . Q15696
Uncharacterized protein NKAPD1 (NKAPD1) . Q6ZUT1
YTH domain-containing protein 1 (YTHDC1) . Q96MU7
Zinc finger CCHC domain-containing protein 10 (ZCCHC10) . Q8TBK6
Zinc finger CCHC domain-containing protein 17 (ZCCHC17) . Q9NP64

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060