Details of the Target
General Information of Target
| Target ID | LDTP11742 | |||||
|---|---|---|---|---|---|---|
| Target Name | RNA-binding protein 38 (RBM38) | |||||
| Gene Name | RBM38 | |||||
| Gene ID | 55544 | |||||
| Synonyms |
RNPC1; SEB4; RNA-binding protein 38; CLL-associated antigen KW-5; HSRNASEB; RNA-binding motif protein 38; RNA-binding region-containing protein 1; ssDNA-binding protein SEB4 |
|||||
| 3D Structure | ||||||
| Sequence |
MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLG
ASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDG RPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQ KINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
RBM38 family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.; (Microbial infection) Essential factor for the splicing of the pre-mRNAs of human parvovirus B19 (B19V) and for the expression of B19V 11-kDa protein, which enhances viral replication.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K35(2.12) | LDD2218 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [2] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0356 | [3] | |
The Interaction Atlas With This Target
References



