Details of the Target
General Information of Target
Target ID | LDTP11727 | |||||
---|---|---|---|---|---|---|
Target Name | Guanylate-binding protein 3 (GBP3) | |||||
Gene Name | GBP3 | |||||
Gene ID | 2635 | |||||
Synonyms |
Guanylate-binding protein 3; EC 3.6.5.-; GTP-binding protein 3; GBP-3; Guanine nucleotide-binding protein 3 |
|||||
3D Structure | ||||||
Sequence |
MAEAEGSSLLLLPPPPPPPRMAEVEAPTAAETDMKQYQGSGGVAMDVERSRFPYCVVWTP
IPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVSEDNMAFGKPAKYWKLDPAQVYASGPNA WDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWNMVTLCFFCLLYGKYVS VGAFVKTWLPFILLLGIILTVSLVFNLR |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3 GTPase family, GB1 subfamily
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Following infection, recruited to the pathogen-containing vacuoles or vacuole-escaped bacteria and acts as a positive regulator of inflammasome assembly by promoting the release of inflammasome ligands from bacteria. Acts by promoting lysis of pathogen-containing vacuoles, releasing pathogens into the cytosol. Following pathogen release in the cytosol, promotes recruitment of proteins that mediate bacterial cytolysis: this liberates ligands that are detected by inflammasomes, such as lipopolysaccharide (LPS) that activates the non-canonical CASP4/CASP11 inflammasome or double-stranded DNA (dsDNA) that activates the AIM2 inflammasome. Exhibits antiviral activity against influenza virus.; [Isoform 2]: Shows the most prominent antiviral activity in epithelial cells.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
C394(0.72) | LDD1702 | [1] | |
IA-alkyne Probe Info |
![]() |
C405(0.00); C268(0.00) | LDD0166 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
References