Details of the Target

General Information of Target

Target ID LDTP11724
Target Name FXYD domain-containing ion transport regulator 6 (FXYD6)
Gene Name FXYD6
Gene ID 53826
Synonyms
FXYD domain-containing ion transport regulator 6; Phosphohippolin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSV
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLK
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Target Bioclass
Transporter and channel
Family
FXYD family
Subcellular location
Membrane
Uniprot ID
Q9H0Q3
Ensemble ID
ENST00000260282.8
HGNC ID
HGNC:4030

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD0005  [1]
NPM
 Probe Info  		N.A.  LDD0016  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 2 (ELOVL2) ELO family Q9NXB9
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
Rhomboid-related protein 1 (RHBDL1) Peptidase S54 family O75783
Ribonuclease kappa (RNASEK) RNase K family Q6P5S7
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
Ceramide synthase 4 (CERS4) . Q9HA82
Transporter and channel
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ammonium transporter Rh type C (RHCG) Ammonium transporter family Q9UBD6
Gamma-secretase subunit APH-1A (APH1A) APH-1 family Q96BI3
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Proton-coupled zinc antiporter SLC30A2 (SLC30A2) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q9BRI3
Claudin-7 (CLDN7) Claudin family O95471
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
Derlin-2 (DERL2) Derlin family Q9GZP9
Novel acetylcholine receptor chaperone (TMEM35A) DoxX family Q53FP2
G protein-activated inward rectifier potassium channel 2 (KCNJ6) Inward rectifier-type potassium channel family P48051
Transmembrane 4 L6 family member 18 (TM4SF18) L6 tetraspanin family Q96CE8
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Synaptic vesicle 2-related protein (SVOP) Major facilitator superfamily Q8N4V2
Monocarboxylate transporter 2 (SLC16A7) Monocarboxylate porter (TC 2.A.1.13) family O60669
ER membrane protein complex subunit 5 (MMGT1) Membrane magnesium transporter (TC 1.A.67) family Q8N4V1
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Multidrug and toxin extrusion protein 1 (SLC47A1) Multi antimicrobial extrusion (MATE) (TC 2.A.66.1) family Q96FL8
Peroxisome assembly protein 12 (PEX12) Pex2/pex10/pex12 family O00623
Solute carrier family 35 member E3 (SLC35E3) TPT transporter family Q7Z769
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Transmembrane protein 72 (TMEM72) . A0PK05
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
N-formyl peptide receptor 2 (FPR2) G-protein coupled receptor 1 family P25090
Other
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
LHFPL tetraspan subfamily member 2 protein (LHFPL2) LHFP family Q6ZUX7
OCIA domain-containing protein 1 (OCIAD1) OCIAD1 family Q9NX40
C-type lectin domain family 10 member A (CLEC10A) . Q8IUN9
Protein APCDD1-like (APCDD1L) . Q8NCL9
Transmembrane protein 154 (TMEM154) . Q6P9G4

References

1 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764