Details of the Target

General Information of Target

Target ID LDTP11693
Target Name Speriolin-like protein (SPATC1L)
Gene Name SPATC1L
Gene ID 84221
Synonyms
C21orf56; Speriolin-like protein; Spermatogenesis and centriole-associated protein 1-like protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKF
ESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKH
LRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADK
FQVLLAELKQAQTLMSSLG
Target Bioclass
Other
Family
Speriolin family
Uniprot ID
Q9H0A9
Ensemble ID
ENST00000291672.6
HGNC ID
HGNC:1298

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
EFO27 SNV: p.P289S .
MFE319 SNV: p.S258G .
NCIH1975 SNV: p.C91F .
OVTOKO SNV: p.L218I .
PC9 SNV: p.P135S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD2156  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) PPP phosphatase family P62140
Exosome complex component RRP43 (EXOSC8) RNase PH family Q96B26
E3 ubiquitin-protein ligase SIAH1 (SIAH1) SINA (Seven in absentia) family Q8IUQ4
ADP-ribosylation factor-like protein 4A (ARL4A) Arf family P40617
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
tRNA (adenine(37)-N6)-methyltransferase (TRMO) TRNA methyltransferase O family Q9BU70
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA-binding protein Ikaros (IKZF1) Ikaros C2H2-type zinc-finger protein family Q13422
Forkhead box protein N1 (FOXN1) . O15353
Transcription factor 4 (TCF4) . P15884
Zinc finger and BTB domain-containing protein 8B (ZBTB8B) . Q8NAP8
Other
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Golgin subfamily A member 6A (GOLGA6A) GOLGA6 family Q9NYA3
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Mitotic interactor and substrate of PLK1 (MISP) MISP family Q8IVT2
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
Synaptonemal complex central element protein 1 (SYCE1) SYCE family Q8N0S2
Tektin-4 (TEKT4) Tektin family Q8WW24
General transcription factor 3C polypeptide 6 (GTF3C6) TFIIIC subunit 6 family Q969F1
Pre-rRNA-processing protein TSR2 homolog (TSR2) TSR2 family Q969E8
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Calcium-binding protein 2 (CABP2) . Q9NPB3
Cytoplasmic protein NCK2 (NCK2) . O43639
Nuclear transport factor 2 (NUTF2) . P61970
PHD finger protein 11 (PHF11) . Q9UIL8
PRKCA-binding protein (PICK1) . Q9NRD5
RNA-binding motif protein, Y chromosome, family 1 member F/J (RBMY1F; RBMY1J) . Q15415
Ubiquitin-like protein 5 (UBL5) . Q9BZL1

References

1 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019