Details of the Target
General Information of Target
| Target ID | LDTP11627 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tubulointerstitial nephritis antigen-like (TINAGL1) | |||||
| Gene Name | TINAGL1 | |||||
| Gene ID | 64129 | |||||
| Synonyms |
GIS5; LCN7; OLRG2; TINAGL; Tubulointerstitial nephritis antigen-like; Glucocorticoid-inducible protein 5; Oxidized LDL-responsive gene 2 protein; OLRG-2; Tubulointerstitial nephritis antigen-related protein; TIN Ag-related protein; TIN-Ag-RP
|
|||||
| 3D Structure | ||||||
| Sequence |
MATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE
EVDADAADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASRAFSLYANIDILRP YFDVEPAQVRSRLLESMIPIKMVNFPQKIAGELYGPLMLVFTLVAILLHGMKTSDTIIRE GTLMGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIH LHALFYLFWLLVGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVV EGILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase C1 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| DU145 | SNV: p.V455I | . | |||
| HCT116 | Deletion: p.P101RfsTer46 | . | |||
| HUH28 | SNV: p.V452L; p.G457D | DBIA Probe Info | |||
| JURKAT | SNV: p.A209D | . | |||
| KELLY | SNV: p.T341A | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C446(1.92) | LDD3314 | [1] | |
Competitor(s) Related to This Target