Details of the Target
General Information of Target
| Target ID | LDTP11578 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein dpy-30 homolog (DPY30) | |||||
| Gene Name | DPY30 | |||||
| Gene ID | 84661 | |||||
| Synonyms |
Protein dpy-30 homolog; Dpy-30-like protein; Dpy-30L |
|||||
| 3D Structure | ||||||
| Sequence |
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLAL
TTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPV ADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCW VCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGA LSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Dpy-30 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone H3 acetylation. In a teratocarcinoma cell, plays a crucial role in retinoic acid-induced differentiation along the neural lineage, regulating gene induction and H3 'Lys-4' methylation at key developmental loci. May also play an indirect or direct role in endosomal transport.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K40(3.29); K45(6.81); K92(5.00) | LDD0277 | [1] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [2] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0358 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [4] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [5] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) | BZIP family | Q68CJ9 | |||
| BEN domain-containing protein 3 (BEND3) | . | Q5T5X7 | |||
Other
References





