Details of the Target

General Information of Target

Target ID LDTP11578
Target Name Protein dpy-30 homolog (DPY30)
Gene Name DPY30
Gene ID 84661
Synonyms
Protein dpy-30 homolog; Dpy-30-like protein; Dpy-30L
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLAL
TTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPV
ADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCW
VCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGA
LSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF
Target Bioclass
Other
Family
Dpy-30 family
Subcellular location
Nucleus
Function
As part of the MLL1/MLL complex, involved in the methylation of histone H3 at 'Lys-4', particularly trimethylation. Histone H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May play some role in histone H3 acetylation. In a teratocarcinoma cell, plays a crucial role in retinoic acid-induced differentiation along the neural lineage, regulating gene induction and H3 'Lys-4' methylation at key developmental loci. May also play an indirect or direct role in endosomal transport.
Uniprot ID
Q9C005
Ensemble ID
ENST00000295066.3
HGNC ID
HGNC:24590

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K40(3.29); K45(6.81); K92(5.00)  LDD0277  [1]
ATP probe
 Probe Info  		N.A.  LDD0199  [2]
1d-yne
 Probe Info  		N.A.  LDD0358  [3]
ATP probe
 Probe Info  		N.A.  LDD0035  [4]
NHS
 Probe Info  		N.A.  LDD0010  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
26S proteasome regulatory subunit 6A (PSMC3) AAA ATPase family P17980
Adenylate kinase 8 (AK8) Adenylate kinase family Q96MA6
26S proteasome non-ATPase regulatory subunit 14 (PSMD14) Peptidase M67A family O00487
Cyclin-dependent kinase 17 (CDK17) CMGC Ser/Thr protein kinase family Q00537
Set1/Ash2 histone methyltransferase complex subunit ASH2 (ASH2L) . Q9UBL3
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) BZIP family Q68CJ9
BEN domain-containing protein 3 (BEND3) . Q5T5X7
Other
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8 (AKAP8) AKAP95 family O43823
Cilia- and flagella-associated protein 91 (CFAP91) CFAP91 family Q7Z4T9
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
DPY30 domain-containing protein 2 (DYDC2) Dpy-30 family Q96IM9
Protein dpy-30 homolog (DPY30) Dpy-30 family Q9C005
Protein FAM136A (FAM136A) FAM136 family Q96C01
Radial spoke head protein 3 homolog (RSPH3) Flagellar radial spoke RSP3 family Q86UC2
MORF4 family-associated protein 1 (MRFAP1) MORF4 family-associated protein family Q9Y605
Testis-specific Y-encoded protein 10 (TSPY10) Nucleosome assembly protein (NAP) family P0CW01
Testis-specific Y-encoded protein 2 (TSPY2) Nucleosome assembly protein (NAP) family A6NKD2
A-kinase anchor protein 14 (AKAP14) . Q86UN6
Abscission/NoCut checkpoint regulator (ZFYVE19) . Q96K21
Chromatin complexes subunit BAP18 (BAP18) . Q8IXM2

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
3 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
4 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
5 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764