Details of the Target
General Information of Target
| Target ID | LDTP11523 | |||||
|---|---|---|---|---|---|---|
| Target Name | ATP-binding cassette sub-family A member 2 (ABCA2) | |||||
| Gene Name | ABCA2 | |||||
| Gene ID | 20 | |||||
| Synonyms |
ABC2; KIAA1062; ATP-binding cassette sub-family A member 2; EC 7.6.2.-; ATP-binding cassette transporter 2; ATP-binding cassette 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQ
IPRNLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKAQSALHEQKT LPGMNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEE CTILRGPDGNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRR MQQMAGQMGMFNPMAIPFGAYGAYAQALMQQQAALMASVAQGGYLNPMAAFAAAQMQQMA ALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFAN GIHPYPAQSPTAADPLQQAYAGVQQYAGPAAYPAAYGQISQAFPQPPPMIPQQQREGPEG CNLFIYHLPQEFGDAELMQMFLPFGFVSFDNPASAQTAIQAMNGFQIGMKRLKVQLKRPK DANRPY |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
ABC transporter superfamily, ABCA family
|
|||||
| Subcellular location |
Endosome membrane
|
|||||
| Function |
Probable lipid transporter that modulates cholesterol sequestration in the late endosome/lysosome by regulating the intracellular sphingolipid metabolism, in turn participates in cholesterol homeostasis (Probable). May alter the transbilayer distribution of ceramide in the intraluminal membrane lipid bilayer, favoring its retention in the outer leaflet that results in increased acid ceramidase activity in the late endosome/lysosome, facilitating ceramide deacylation to sphingosine leading to the sequestration of free cholesterol in lysosomes. In addition regulates amyloid-beta production either by activating a signaling pathway that regulates amyloid precursor protein transcription through the modulation of sphingolipid metabolism or through its role in gamma-secretase processing of APP. May play a role in myelin formation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C1070(1.73) | LDD3383 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [2] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [3] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [4] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [5] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0215 | AC10 | HEK-293T | C1201(0.99) | LDD1508 | [7] |
| LDCM0277 | AC18 | HEK-293T | C1201(0.93) | LDD1516 | [7] |
| LDCM0279 | AC2 | HEK-293T | C1201(0.80) | LDD1518 | [7] |
| LDCM0286 | AC26 | HEK-293T | C1201(0.94) | LDD1525 | [7] |
| LDCM0295 | AC34 | HEK-293T | C1201(1.12) | LDD1534 | [7] |
| LDCM0304 | AC42 | HEK-293T | C1201(1.17) | LDD1543 | [7] |
| LDCM0313 | AC50 | HEK-293T | C1201(1.41) | LDD1552 | [7] |
| LDCM0321 | AC58 | HEK-293T | C1201(1.12) | LDD1560 | [7] |
| LDCM0367 | CL1 | HEK-293T | C2265(0.90) | LDD1571 | [7] |
| LDCM0370 | CL101 | HEK-293T | C2265(1.04) | LDD1574 | [7] |
| LDCM0374 | CL105 | HEK-293T | C2265(1.02) | LDD1578 | [7] |
| LDCM0378 | CL109 | HEK-293T | C2265(1.08) | LDD1582 | [7] |
| LDCM0383 | CL113 | HEK-293T | C2265(1.11) | LDD1587 | [7] |
| LDCM0387 | CL117 | HEK-293T | C2265(0.97) | LDD1591 | [7] |
| LDCM0392 | CL121 | HEK-293T | C2265(1.02) | LDD1596 | [7] |
| LDCM0396 | CL125 | HEK-293T | C2265(0.96) | LDD1600 | [7] |
| LDCM0400 | CL13 | HEK-293T | C2265(0.89) | LDD1604 | [7] |
| LDCM0405 | CL18 | HEK-293T | C1201(1.17) | LDD1609 | [7] |
| LDCM0413 | CL25 | HEK-293T | C2265(1.24) | LDD1617 | [7] |
| LDCM0419 | CL30 | HEK-293T | C1201(0.99) | LDD1623 | [7] |
| LDCM0426 | CL37 | HEK-293T | C2265(1.26) | LDD1630 | [7] |
| LDCM0432 | CL42 | HEK-293T | C1201(1.11) | LDD1636 | [7] |
| LDCM0439 | CL49 | HEK-293T | C2265(1.13) | LDD1643 | [7] |
| LDCM0445 | CL54 | HEK-293T | C1201(1.13) | LDD1648 | [7] |
| LDCM0451 | CL6 | HEK-293T | C1201(1.95) | LDD1654 | [7] |
| LDCM0453 | CL61 | HEK-293T | C2265(1.07) | LDD1656 | [7] |
| LDCM0458 | CL66 | HEK-293T | C1201(1.24) | LDD1661 | [7] |
| LDCM0466 | CL73 | HEK-293T | C2265(1.05) | LDD1669 | [7] |
| LDCM0471 | CL78 | HEK-293T | C1201(1.05) | LDD1674 | [7] |
| LDCM0479 | CL85 | HEK-293T | C2265(0.89) | LDD1682 | [7] |
| LDCM0485 | CL90 | HEK-293T | C1201(0.99) | LDD1688 | [7] |
| LDCM0492 | CL97 | HEK-293T | C2265(1.11) | LDD1695 | [7] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [5] |
| LDCM0022 | KB02 | A2780 | C1070(1.56) | LDD2254 | [1] |
| LDCM0023 | KB03 | A2780 | C1070(1.91) | LDD2671 | [1] |
| LDCM0024 | KB05 | OVCAR-5 | C1070(1.73) | LDD3383 | [1] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [5] |
References






