Details of the Target
General Information of Target
| Target ID | LDTP11470 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 341 (ZNF341) | |||||
| Gene Name | ZNF341 | |||||
| Gene ID | 84905 | |||||
| Synonyms |
Zinc finger protein 341 |
|||||
| 3D Structure | ||||||
| Sequence |
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPA
KVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQS TLSDLRVYLGASTPDLQ |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | Transcriptional activator of STAT3 involved in the regulation of immune homeostasis. Also able to activate STAT1 transcription. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
C756(20.00) | LDD2227 | [1] | |
Competitor(s) Related to This Target

