Details of the Target
General Information of Target
| Target ID | LDTP11425 | |||||
|---|---|---|---|---|---|---|
| Target Name | Electrogenic sodium bicarbonate cotransporter 4 (SLC4A5) | |||||
| Gene Name | SLC4A5 | |||||
| Gene ID | 57835 | |||||
| Synonyms |
NBC4; Electrogenic sodium bicarbonate cotransporter 4; NBCe2; Solute carrier family 4 member 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQ
PILQYRWDIMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDH HDEFCLMP |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Anion exchanger (TC 2.A.31) family
|
|||||
| Subcellular location |
Apical cell membrane
|
|||||
| Function | Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na(+):HCO3(-) stoichiometry varying from 1:2 to 1:3. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
 |
N.A. | LDD0148 | [1] | |