Details of the Target
General Information of Target
Target ID | LDTP11424 | |||||
---|---|---|---|---|---|---|
Target Name | Protein BEX2 (BEX2) | |||||
Gene Name | BEX2 | |||||
Gene ID | 84707 | |||||
Synonyms |
Protein BEX2; Brain-expressed X-linked protein 2; hBex2 |
|||||
3D Structure | ||||||
Sequence |
MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL HLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREII QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLES SKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH |
|||||
Target Bioclass |
Other
|
|||||
Family |
BEX family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity. In absence of reductive stress, acts as a pseudosubstrate for the CRL2(FEM1B) complex: associates with FEM1B via zinc, thereby preventing association between FEM1B and its substrates.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C47(0.89) | LDD1575 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0371 | CL102 | HEK-293T | C47(0.89) | LDD1575 | [1] |
LDCM0375 | CL106 | HEK-293T | C47(0.87) | LDD1579 | [1] |
LDCM0380 | CL110 | HEK-293T | C47(0.83) | LDD1584 | [1] |
LDCM0384 | CL114 | HEK-293T | C47(0.53) | LDD1588 | [1] |
LDCM0388 | CL118 | HEK-293T | C47(1.01) | LDD1592 | [1] |
LDCM0393 | CL122 | HEK-293T | C47(0.82) | LDD1597 | [1] |
LDCM0397 | CL126 | HEK-293T | C47(0.91) | LDD1601 | [1] |
LDCM0401 | CL14 | HEK-293T | C47(1.04) | LDD1605 | [1] |
LDCM0407 | CL2 | HEK-293T | C47(0.89) | LDD1611 | [1] |
LDCM0414 | CL26 | HEK-293T | C47(0.93) | LDD1618 | [1] |
LDCM0441 | CL50 | HEK-293T | C47(0.80) | LDD1645 | [1] |
LDCM0454 | CL62 | HEK-293T | C47(1.13) | LDD1657 | [1] |
LDCM0467 | CL74 | HEK-293T | C47(0.84) | LDD1670 | [1] |
LDCM0480 | CL86 | HEK-293T | C47(1.08) | LDD1683 | [1] |
LDCM0493 | CL98 | HEK-293T | C47(0.80) | LDD1696 | [1] |
LDCM0427 | Fragment51 | HEK-293T | C47(0.88) | LDD1631 | [1] |