Details of the Target
General Information of Target
Target ID | LDTP11359 | |||||
---|---|---|---|---|---|---|
Target Name | Receptor for retinol uptake STRA6 (STRA6) | |||||
Gene Name | STRA6 | |||||
Gene ID | 64220 | |||||
Synonyms |
Receptor for retinol uptake STRA6; Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog |
|||||
3D Structure | ||||||
Sequence |
MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKD
PKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYS YKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSS YIIDYYGTRLTRLSITNETFRKTQLYP |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Functions as a retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid. STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency (Probable). Does not transport retinoic acid.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C233(3.71) | LDD2305 | [1] | |
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
NADH dehydrogenase 1 beta subcomplex subunit 7 (NDUFB7) | Complex I NDUFB7 subunit family | P17568 | |||
Glutaredoxin-3 (GLRX3) | . | O76003 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Keratin-associated protein 10-6 (KRTAP10-6) | KRTAP type 10 family | P60371 | |||
Late cornified envelope protein 2C (LCE2C) | LCE family | Q5TA81 |
References