General Information of Target

Target ID LDTP11359
Target Name Receptor for retinol uptake STRA6 (STRA6)
Gene Name STRA6
Gene ID 64220
Synonyms
Receptor for retinol uptake STRA6; Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCEDLKVGQYICKD
PKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYS
YKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSS
YIIDYYGTRLTRLSITNETFRKTQLYP
Target Bioclass
Transporter and channel
Subcellular location
Cell membrane
Function
Functions as a retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid. STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency (Probable). Does not transport retinoic acid.
Uniprot ID
Q9BX79
Ensemble ID
ENST00000323940.9
HGNC ID
HGNC:30650

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
ABC1 Deletion: p.K258RfsTer22 .
FTC133 SNV: p.W274R .
HEL SNV: p.S112N .
HEL9217 SNV: p.S112N .
KYSE510 SNV: p.G83S .
REC1 Deletion: p.A300VfsTer3 .
TC71 SNV: p.Q75K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C233(3.71)  LDD2305  [1]
WYneN
 Probe Info 
N.A.  LDD0021  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 COLO-679 C233(3.71)  LDD2305  [1]
 LDCM0023  KB03 COLO-679 C233(5.37)  LDD2722  [1]
 LDCM0024  KB05 COLO-679 C233(4.05)  LDD3139  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH dehydrogenase 1 beta subcomplex subunit 7 (NDUFB7) Complex I NDUFB7 subunit family P17568
Glutaredoxin-3 (GLRX3) . O76003
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Keratin-associated protein 10-6 (KRTAP10-6) KRTAP type 10 family P60371
Late cornified envelope protein 2C (LCE2C) LCE family Q5TA81

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Vitamin A Small molecular drug DB00162

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764