Details of the Target
General Information of Target
| Target ID | LDTP11352 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tapasin-related protein (TAPBPL) | |||||
| Gene Name | TAPBPL | |||||
| Gene ID | 55080 | |||||
| Synonyms |
Tapasin-related protein; TAPASIN-R; TAP-binding protein-like; TAP-binding protein-related protein; TAPBP-R; Tapasin-like |
|||||
| 3D Structure | ||||||
| Sequence |
MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA
DRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAH YVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAA SPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQPQQLQTDRMQ |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Component of the antigen processing and presentation pathway, which binds to MHC class I coupled with beta2-microglobulin/B2M. Association between TAPBPR and MHC class I occurs in the absence of a functional peptide-loading complex (PLC).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C39(1.52) | LDD3325 | [1] | |
Competitor(s) Related to This Target

