Details of the Target
General Information of Target
| Target ID | LDTP11275 | |||||
|---|---|---|---|---|---|---|
| Target Name | ER degradation-enhancing alpha-mannosidase-like protein 2 (EDEM2) | |||||
| Gene Name | EDEM2 | |||||
| Gene ID | 55741 | |||||
| Synonyms |
C20orf31; C20orf49; ER degradation-enhancing alpha-mannosidase-like protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQS
ATVLDLKKAIQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNR DEVSFIKKLRQK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyl hydrolase 47 family
|
|||||
| Subcellular location |
Endoplasmic reticulum lumen
|
|||||
| Function |
Involved in the endoplasmic reticulum-associated degradation (ERAD) pathway that targets misfolded glycoproteins for degradation in an N-glycan-dependent manner. May initiate ERAD by promoting the first mannose trimming step of ERAD substrates, from Man9GlcNAc2 to Man8GlcNAc2. Seems to recognize and bind to exposed hydrophobic regions in target proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C558(2.60) | LDD3325 | [1] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [2] | |
Competitor(s) Related to This Target
References


