Details of the Target
General Information of Target
Target ID | LDTP11262 | |||||
---|---|---|---|---|---|---|
Target Name | Mitochondrial adenyl nucleotide antiporter SLC25A23 (SLC25A23) | |||||
Gene Name | SLC25A23 | |||||
Gene ID | 79085 | |||||
Synonyms |
APC2; MCSC2; SCAMC3; Mitochondrial adenyl nucleotide antiporter SLC25A23; Mitochondrial ATP-Mg/Pi carrier protein 2; Short calcium-binding mitochondrial carrier protein 3; SCaMC-3; Solute carrier family 25 member 23
|
|||||
3D Structure | ||||||
Sequence |
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Mitochondrial carrier (TC 2.A.29) family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Electroneutral antiporter that mediates the transport of adenine nucleotides through the inner mitochondrial membrane. Originally identified as an ATP-magnesium/inorganic phosphate antiporter, it also acts as a broad specificity adenyl nucleotide antiporter. By regulating the mitochondrial matrix adenine nucleotide pool could adapt to changing cellular energetic demands and indirectly regulate adenine nucleotide-dependent metabolic pathways. Also acts as a regulator of mitochondrial calcium uptake and can probably transport trace amounts of other divalent metal cations in complex with ATP. In vitro, a low activity is also observed with guanyl and pyrimidine nucleotides.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [1] |
The Interaction Atlas With This Target