Details of the Target
General Information of Target
Target ID | LDTP11254 | |||||
---|---|---|---|---|---|---|
Target Name | GEL complex subunit OPTI (RAB5IF) | |||||
Gene Name | RAB5IF | |||||
Gene ID | 55969 | |||||
Synonyms |
C20orf24; OPTI; RCAF1; GEL complex subunit OPTI; Obligate partner of TMCO1 insertase; Rab5-interacting protein; RIP5; Respirasome Complex Assembly Factor 1 |
|||||
3D Structure | ||||||
Sequence |
MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRSHSRVSSRFSSRSRRS
KSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRYYRSPSRYRSRSRSRSR SRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSRSRTPFRLSEKDRMELLE IAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAKPELSEKVTEDGTRNPNEK PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKKSPYGLWIPI |
|||||
Target Bioclass |
Other
|
|||||
Family |
EMC6 family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function |
Component of the multi-pass translocon (MPT) complex that mediates insertion of multi-pass membrane proteins into the lipid bilayer of membranes. The MPT complex takes over after the SEC61 complex: following membrane insertion of the first few transmembrane segments of proteins by the SEC61 complex, the MPT complex occludes the lateral gate of the SEC61 complex to promote insertion of subsequent transmembrane regions. Within the MPT complex, the GEL subcomplex may mediate insertion of transmembrane regions into the membrane. In addition to its role in multi-pass membrane insertion, RAB5IF/OPTI also acts as an assembly factor for mitochondrial respiratory complexes.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K27(4.91) | LDD0277 | [1] |