Details of the Target
General Information of Target
| Target ID | LDTP11218 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 692 (ZNF692) | |||||
| Gene Name | ZNF692 | |||||
| Gene ID | 55657 | |||||
| Synonyms |
AREBP; ZFP692; Zinc finger protein 692; AICAR responsive element binding protein |
|||||
| 3D Structure | ||||||
| Sequence |
MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS
GWELKCPGAAGVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVAS FVTKRSAWKLVLLGADEEEPQLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSS MLGVPAQETAPAKLIVYLQRFRPQDYQRLLEVNSSRERPQETEDPDHCLG |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May act as an transcriptional repressor for PCK1 gene expression, in turn may participate in the hepatic gluconeogenesis regulation through the activated AMPK signaling pathway. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C99(2.03) | LDD3484 | [1] | |
|
TFBX Probe Info |
 |
N.A. | LDD0027 | [2] | |
|
IPM Probe Info |
 |
N.A. | LDD0147 | [2] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0632 | CL-Sc | Hep-G2 | C235(20.00); C148(1.00) | LDD2227 | [3] |
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C235(0.95) | LDD1702 | [4] |
| LDCM0022 | KB02 | A101D | C240(2.04) | LDD2250 | [1] |
| LDCM0023 | KB03 | MDA-MB-231 | C235(2.04) | LDD1701 | [4] |
| LDCM0024 | KB05 | UACC-62 | C99(2.03) | LDD3484 | [1] |
The Interaction Atlas With This Target
References