Details of the Target
General Information of Target
| Target ID | LDTP11171 | |||||
|---|---|---|---|---|---|---|
| Target Name | tRNA-splicing endonuclease subunit Sen34 (TSEN34) | |||||
| Gene Name | TSEN34 | |||||
| Gene ID | 79042 | |||||
| Synonyms |
LENG5; SEN34; tRNA-splicing endonuclease subunit Sen34; EC 4.6.1.16; Leukocyte receptor cluster member 5; tRNA-intron endonuclease Sen34; HsSen34 |
|||||
| 3D Structure | ||||||
| Sequence |
MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALH LYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQET QGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSESSDSTS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TRNA-intron endonuclease family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. It probably carries the active site for 3'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C291(2.33) | LDD3334 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [4] | |
Competitor(s) Related to This Target
References





