Details of the Target

General Information of Target

Target ID	LDTP11156
Target Name	Zinc finger protein 2 (ZNF2)
Gene Name	ZNF2
Gene ID	7549
Synonyms	ZNF661; Zinc finger protein 2; Zinc finger protein 2.2; Zinc finger protein 661
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILE YAHRLSQDILCDALQQWACNNIKYHDIPYIESEGP
Target Bioclass	Transcription factor
Family	Krueppel C2H2-type zinc-finger protein family
Subcellular location	Nucleus
Function	May be involved in transcriptional regulation.
Uniprot ID	Q9BSG1
Ensemble ID	ENST00000614034.5
HGNC ID	HGNC:12991

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
IA-alkyne Probe Info			N.A.	LDD0165	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
E3 ubiquitin-protein ligase TRIM41 (TRIM41)				TRIM/RBCC family	Q8WV44

Transporter and channel

Click To Hide/Show 2 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Huntingtin (HTT)				Huntingtin family	P42858
Sperm protein associated with the nucleus on the X chromosome N2 (SPANXN2)				SPAN-X family	Q5MJ10

Other

Click To Hide/Show 3 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Testis-specific gene 10 protein (TSGA10)	CEP135/TSGA10 family	Q9BZW7
Segment polarity protein dishevelled homolog DVL-3 (DVL3)	DSH family	Q92997
Keratin-associated protein 10-7 (KRTAP10-7)	KRTAP type 10 family	P60409

References

1	SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18. Mass spectrometry data entry*: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060