Details of the Target

General Information of Target

Target ID LDTP11153
Target Name Transmembrane protein 79 (TMEM79)
Gene Name TMEM79
Gene ID 84283
Synonyms
MATT; Transmembrane protein 79; Mattrin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRG
PLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMEL
FSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPD
IVTCVQSSRK
Target Bioclass
Transporter and channel
Subcellular location
Lysosome
Function Contributes to the epidermal integrity and skin barrier function. Plays a role in the lamellar granule (LG) secretory system and in the stratum corneum (SC) epithelial cell formation.
Uniprot ID
Q9BSE2
Ensemble ID
ENST00000295694.9
HGNC ID
HGNC:28196

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C383(2.89)  LDD3367  [1]
NAIA_5
 Probe Info  		N.A.  LDD2225  [2]
Acrolein
 Probe Info  		N.A.  LDD0217  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [3]
 LDCM0022  KB02 A101D C383(1.94)  LDD2250  [1]
 LDCM0023  KB03 A101D C383(2.91)  LDD2667  [1]
 LDCM0024  KB05 NUGC-3 C383(2.89)  LDD3367  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH-cytochrome b5 reductase 3 (CYB5R3) Flavoprotein pyridine nucleotide cytochrome reductase family P00387
E3 ubiquitin-protein ligase pellino homolog 2 (PELI2) Pellino family Q9HAT8
Transmembrane protease serine 4 (TMPRSS4) Peptidase S1 family Q9NRS4
E3 ubiquitin-protein ligase RNF8 (RNF8) RNF8 family O76064
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
GTPase IMAP family member 1 (GIMAP1) AIG1/Toc34/Toc159-like paraseptin GTPase family Q8WWP7
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sarcolipin (SLN) Sarcolipin family O00631
Transmembrane protein 14C (TMEM14C) TMEM14 family Q9P0S9
Sigma intracellular receptor 2 (TMEM97) TMEM97/sigma-2 receptor family Q5BJF2
Translocating chain-associated membrane protein 1-like 1 (TRAM1L1) TRAM family Q8N609
Proteolipid protein 2 (PLP2) . Q04941
Transmembrane protein 100 (TMEM100) . Q9NV29
Transmembrane protein 79 (TMEM79) . Q9BSE2
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lysophosphatidic acid receptor 3 (LPAR3) G-protein coupled receptor 1 family Q9UBY5
G-protein coupled receptor family C group 5 member D (GPRC5D) G-protein coupled receptor 3 family Q9NZD1
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amphoterin-induced protein 1 (AMIGO1) AMIGO family Q86WK6
Poliovirus receptor (PVR) Nectin family P15151
Other
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein D (APOD) Lipocalin family P05090
Tenomodulin (TNMD) Chondromodulin-1 family Q9H2S6
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Ubiquinone biosynthesis protein COQ9, mitochondrial (COQ9) COQ9 family O75208
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1) LDLR family Q5T700
Stress-associated endoplasmic reticulum protein 1 (SERP1) RAMP4 family Q9Y6X1
Protein reprimo (RPRM) Reprimo family Q9NS64
Vesicle-trafficking protein SEC22a (SEC22A) Synaptobrevin family Q96IW7
Zinc finger CCHC domain-containing protein 12 (ZCCHC12) ZCCHC12 family Q6PEW1
C-type lectin domain family 7 member A (CLEC7A) . Q9BXN2
Fibronectin type III domain-containing protein 9 (FNDC9) . Q8TBE3
Pulmonary surfactant-associated protein C (SFTPC) . P11686
Testis-expressed protein 264 (TEX264) . Q9Y6I9
Transmembrane protein 254 (TMEM254) . Q8TBM7

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.