Details of the Target
General Information of Target
| Target ID | LDTP11119 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription factor Ovo-like 2 (OVOL2) | |||||
| Gene Name | OVOL2 | |||||
| Gene ID | 58495 | |||||
| Synonyms |
ZNF339; Transcription factor Ovo-like 2; hOvo2; Zinc finger protein 339 |
|||||
| 3D Structure | ||||||
| Sequence |
MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSI
HFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQ KVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFR MEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYL YLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSD CGV |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Zinc-finger transcription repressor factor. Plays a critical role in maintaining the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition (EMT) mainly through the repression of ZEB1, an EMT inducer. Positively regulates neuronal differentiation. Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1. Important for the correct development of primordial germ cells in embryos. Plays dual functions in thermogenesis and adipogenesis to maintain energy balance. Essential for brown/beige adipose tissue-mediated thermogenesis, is necessary for the development of brown adipocytes. In white adipose tissues, limits adipogenesis by blocking CEBPA binding to its transcriptional targets and inhibiting its transcription factor activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A673 | SNV: p.Q202Ter | . | |||
| HCT116 | SNV: p.T168A | . | |||
| LNCaP clone FGC | SNV: p.Q186H | DBIA Probe Info | |||
| LS180 | SNV: p.E191A | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C56(2.05) | LDD3364 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [2] | |
Competitor(s) Related to This Target
References


