Details of the Target
General Information of Target
| Target ID | LDTP11112 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mesoderm posterior protein 1 (MESP1) | |||||
| Gene Name | MESP1 | |||||
| Gene ID | 55897 | |||||
| Synonyms |
BHLHC5; Mesoderm posterior protein 1; Class C basic helix-loop-helix protein 5; bHLHc5 |
|||||
| 3D Structure | ||||||
| Sequence |
MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLL
GFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLE QLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVL NMMPEEKLVEALAAATEKQKKALEKLLPASS |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

