Details of the Target
General Information of Target
| Target ID | LDTP11109 | |||||
|---|---|---|---|---|---|---|
| Target Name | SH2 domain-containing protein 3A (SH2D3A) | |||||
| Gene Name | SH2D3A | |||||
| Gene ID | 10045 | |||||
| Synonyms |
NSP1; SH2 domain-containing protein 3A; Novel SH2-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLF
NNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQ NNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
|||||
| Target Bioclass |
Other
|
|||||
| Function | May play a role in JNK activation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CCK81 | SNV: p.G33D | DBIA Probe Info | |||
| COLO792 | SNV: p.E160K Substitution: p.G408R |
. | |||
| HCC1395 | SNV: p.E265G | . | |||
| KP4 | SNV: p.L372M | . | |||
| MCC13 | SNV: p.Q79Ter | . | |||
| OCILY3 | SNV: p.A187D | . | |||
| SKMEL2 | SNV: p.E8K | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K560(5.99) | LDD0277 | [1] | |
|
DBIA Probe Info |
 |
C51(2.06) | LDD3354 | [2] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2225 | [3] | |
Competitor(s) Related to This Target
References