Details of the Target
General Information of Target
| Target ID | LDTP11062 | |||||
|---|---|---|---|---|---|---|
| Target Name | F-box-like/WD repeat-containing protein TBL1Y (TBL1Y) | |||||
| Gene Name | TBL1Y | |||||
| Gene ID | 90665 | |||||
| Synonyms |
TBL1; F-box-like/WD repeat-containing protein TBL1Y; Transducin beta-like protein 1Y; Transducin-beta-like protein 1, Y-linked |
|||||
| 3D Structure | ||||||
| Sequence |
MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGR
GPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRA PPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQG DPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEK SLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
WD repeat EBI family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C553(1.58) | LDD3410 | [1] | |
|
HHS-475 Probe Info |
 |
Y466(0.69) | LDD0264 | [2] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0221 | [3] | |
|
HHS-465 Probe Info |
 |
N.A. | LDD2240 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [3] |
| LDCM0116 | HHS-0101 | DM93 | Y466(0.69) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y466(0.91) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y466(0.83) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y466(0.88) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y466(0.82) | LDD0268 | [2] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [3] |
| LDCM0022 | KB02 | A-375 | C553(1.53) | LDD2255 | [1] |
| LDCM0023 | KB03 | A-375 | C553(2.03) | LDD2672 | [1] |
| LDCM0024 | KB05 | RPMI-7951 | C553(1.58) | LDD3410 | [1] |
| LDCM0109 | NEM | HeLa | H358(0.00); H306(0.00) | LDD0223 | [3] |
References