Details of the Target
General Information of Target
| Target ID | LDTP11056 | |||||
|---|---|---|---|---|---|---|
| Target Name | U6 snRNA phosphodiesterase 1 (USB1) | |||||
| Gene Name | USB1 | |||||
| Gene ID | 79650 | |||||
| Synonyms |
C16orf57; Mpn1; U6 snRNA phosphodiesterase 1; hUsb1; 3'-5' RNA exonuclease USB1; EC 4.6.1.-; Mutated in poikiloderma with neutropenia protein 1; Mutated in PN protein 1; hMpn1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAARGRRAEPQGREAPGPAGGGGGGSRWAESGSGTSPESGDEEVSGAGSSPVSGGVNLFA
NDGSFLELFKRKMEEEQRQRQEEPPPGPQRPDQSAAAAGPGDPKRKGGPGSTLSFVGKRR GGNKLALKTGIVAKKQKTEDEVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTRPLVK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
2H phosphoesterase superfamily, USB1 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
3'-5' RNA exonuclease that trims the 3' end of oligo(U) and oligo(A) tracts of the pre-U6 small nuclear RNA (snRNA) molecule, leading to the formation of a mature U6 snRNA 3' end-terminated with a 2',3'-cyclic phosphate. Participates in the U6 snRNA 3' end processing that prevents U6 snRNA degradation. In addition also removes uridines from the 3' end of U6atac snRNA and possibly the vault RNA VTRNA1-1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K258(0.63) | LDD0277 | [1] | |

