Details of the Target
General Information of Target
| Target ID | LDTP11043 | |||||
|---|---|---|---|---|---|---|
| Target Name | Spindlin-2B (SPIN2B) | |||||
| Gene Name | SPIN2B | |||||
| Gene ID | 474343 | |||||
| Synonyms |
SPIN2; Spindlin-2B; Spindlin-like protein 2B; SPIN-2; SPIN-2B |
|||||
| 3D Structure | ||||||
| Sequence |
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRR
SEGLPSECRSVTD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SPIN/STSY family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | Involved in the regulation of cell cycle progression, this activity is related to the inhibition of apoptosis following the removal of essential growth factors. Exhibits H3K4me3-binding activity. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [1] | |
The Interaction Atlas With This Target

