Details of the Target
General Information of Target
| Target ID | LDTP11002 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sodium-dependent proline transporter (SLC6A7) | |||||
| Gene Name | SLC6A7 | |||||
| Gene ID | 6534 | |||||
| Synonyms |
PROT; Sodium-dependent proline transporter; Solute carrier family 6 member 7 |
|||||
| 3D Structure | ||||||
| Sequence |
MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family, SLC6A7 subfamily
|
|||||
| Subcellular location |
Synaptic cell membrane
|
|||||
| Function | Brain specific sodium (and chloride)-dependent proline transporter. Terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals (Probable). | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Crotonaldehyde Probe Info |
 |
N.A. | LDD0219 | [1] | |
The Interaction Atlas With This Target