Details of the Target
General Information of Target
| Target ID | LDTP10964 | |||||
|---|---|---|---|---|---|---|
| Target Name | Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) | |||||
| Gene Name | LITAF | |||||
| Gene ID | 9516 | |||||
| Synonyms |
PIG7; SIMPLE; Lipopolysaccharide-induced tumor necrosis factor-alpha factor; LPS-induced TNF-alpha factor; Small integral membrane protein of lysosome/late endosome; p53-induced gene 7 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CDIP1/LITAF family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps down-regulate downstream signaling cascades. Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines. May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K159(5.83) | LDD0277 | [1] | |
|
Probe 1 Probe Info |
 |
Y158(12.78) | LDD3495 | [2] | |
References