Details of the Target
General Information of Target
Target ID | LDTP10955 | |||||
---|---|---|---|---|---|---|
Target Name | Collagen alpha-1(XII) chain (COL12A1) | |||||
Gene Name | COL12A1 | |||||
Gene ID | 1303 | |||||
Synonyms |
COL12A1L; Collagen alpha-1(XII) chain |
|||||
3D Structure | ||||||
Sequence |
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL PIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAI IENPFLNGEVIRLDGAIRMQP |
|||||
Target Bioclass |
Other
|
|||||
Family |
Fibril-associated collagens with interrupted helices (FACIT) family
|
|||||
Subcellular location |
Secreted, extracellular space, extracellular matrix
|
|||||
Function |
Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
ABC1 | SNV: p.R754Ter | . | |||
AN3CA | Insertion: p.S661FfsTer13 | DBIA Probe Info | |||
AU565 | SNV: p.S234C | . | |||
CCK81 | SNV: p.G1131E; p.P3000H | . | |||
COLO320 | SNV: p.Q2392E | . | |||
COLO800 | SNV: p.E174K | DBIA Probe Info | |||
CORL88 | SNV: p.D171H; p.V1967A; p.Y1968N | DBIA Probe Info | |||
DU145 | SNV: p.S1411I; p.A1867T; p.S2871N | . | |||
EFO27 | SNV: p.Y1061H | DBIA Probe Info | |||
HCC44 | SNV: p.P2885A | DBIA Probe Info | |||
HCT15 | SNV: p.V1218A; p.K2650N | . | |||
HEC1 | SNV: p.T1448I | DBIA Probe Info | |||
HEC1B | SNV: p.T1448I | . | |||
HGC27 | SNV: p.S2994L | . | |||
HT | SNV: p.T1469A | . | |||
HT115 | SNV: p.G220W; p.K1094N; p.R1834W; p.E2165A; p.K2557N | . | |||
IGROV1 | Deletion: p.N229IfsTer65 | . | |||
Ishikawa (Heraklio) 02 ER | SNV: p.V1543I | . | |||
JM1 | SNV: p.F2345L; p.A2385D | . | |||
KMS11 | SNV: p.G126R | . | |||
KYSE180 | SNV: p.F2132V | DBIA Probe Info | |||
KYSE30 | SNV: p.P2856L | . | |||
MEC1 | SNV: p.T387A | . | |||
MEWO | SNV: p.R727Ter | . | |||
MOLT4 | SNV: p.G799V | . | |||
NCIH196 | Substitution: p.G2064F | . | |||
NCIH23 | SNV: p.P2943T | . | |||
NCIH446 | SNV: p.T3017A | . | |||
RH41 | SNV: p.G2963E | . | |||
SHP77 | SNV: p.G2809V | . | |||
SUPT1 | SNV: p.R486L | . | |||
SW480 | SNV: p.E344K | . | |||
SW756 | SNV: p.Q183Ter | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C431(2.01) | LDD3318 | [1] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [2] |
Competitor(s) Related to This Target
References