Details of the Target
General Information of Target
| Target ID | LDTP10906 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein FEV (FEV) | |||||
| Gene Name | FEV | |||||
| Gene ID | 54738 | |||||
| Synonyms |
PET1; Protein FEV; Fifth Ewing variant protein; PC12 ETS domain-containing transcription factor 1; PC12 ETS factor 1; Pet-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQ
VRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQV RHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVRE IRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
ETS family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Functions as a transcriptional regulator. According toit functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY-1 Probe Info |
 |
N.A. | LDD0246 | [1] | |