Details of the Target

General Information of Target

Target ID LDTP10853
Target Name Mucin-4 (MUC4)
Gene Name MUC4
Gene ID 4585
Synonyms
Mucin-4; MUC-4; Ascites sialoglycoprotein; ASGP; Pancreatic adenocarcinoma mucin; Testis mucin; Tracheobronchial mucin) [Cleaved into: Mucin-4 alpha chain; Ascites sialoglycoprotein 1; ASGP-1; Mucin-4 beta chain; Ascites sialoglycoprotein 2; ASGP-2)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW
GTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLY
SRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQA
KKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSS
SNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRG
STSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNP
STPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVG
PSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNH
SVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKS
DDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKEL
GRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAE
PPTTLPGTHPGLSETTNPMGHM
Target Bioclass
Other
Subcellular location
Secreted; Cell membrane
Function
Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces. These glycoproteins play important roles in the protection of the epithelium and are implicated in epithelial renewal and differentiation. Regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its ability to act as an intramembrane ligand for ERBB2. Plays an important role in proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. In polarized epithelial cells, segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Its ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation.
Uniprot ID
Q99102
Ensemble ID
ENST00000346145.8
HGNC ID
HGNC:7514

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 Deletion: p.P380LfsTer10
Substitution: p.S1669D		 .
42MGBA Deletion: p.S2661_T2692del .
769P Substitution: p.A998T; p.T3620S .
786O SNV: p.S3432A
Substitution: p.S3541D;p.L3542T;p.A4086T		 .
8505C Substitution: p.A4086T .
A101D Substitution: p.A998T; p.S3541D; p.L3542T .
A204 Substitution: p.T3942L; p.A4086T; p.V4169A; p.S4181D .
A2058 Substitution: p.A998T; p.S3541D; p.L3542T; p.R3974A .
A2780 Substitution: p.D1461S; p.D3285S; p.T3286F; p.A4086T .
A375 SNV: p.G4702R
Substitution: p.P2070V		 .
A431 Substitution: p.T3942L .
A498 SNV: p.P1378H
Substitution: p.E2741_T2742delinsDA;p.V2825A		 .
A549 Substitution: p.V3993S .
AGS SNV: p.D2397Y .
AN3CA Deletion: p.P3554_L3585del
SNV: p.T975A;p.L2401R
Substitution: p.D2197S		 .
AU565 Substitution: p.S4181D .
BICR22 SNV: p.P1378H .
BT549 SNV: p.L1410H .
C32 Substitution: p.S3541D; p.L3542T .
C4II Substitution: p.E2741_T2742delinsDA DBIA    Probe Info 
CAL120 SNV: p.A3054G
Substitution: p.A998T		 .
CAL148 SNV: p.D1989E .
CAL27 Deletion: p.P2978_L3025del
Substitution: p.S3541D;p.L3542T		 DBIA    Probe Info 
CAL33 Deletion: p.V3305_S3336del
SNV: p.V4009L		 .
CAL51 Substitution: p.A998T; p.S1669D; p.T3942L; p.A4086T .
CAL72 Deletion: p.D2261_T2292del .
CALU1 Substitution: p.R3616S .
CALU6 Substitution: p.G2012A .
CAMA1 Substitution: p.D1461S; p.P3312S .
CAOV3 Substitution: p.T3620S .
CASKI SNV: p.L1410H
Substitution: p.T3942L		 DBIA    Probe Info 
CCK81 SNV: p.A4217T
Substitution: p.S3248P		 .
CCLP1 Deletion: p.D2979_P3010del
Substitution: p.A4086T		 DBIA    Probe Info 
CHL1 Deletion: p.A2782_H2797del .
COLO320 Substitution: p.T3910L .
COLO678 Deletion: p.V3305_S3336del
Substitution: p.T3910L		 DBIA    Probe Info 
COLO800 SNV: p.T5319P .
COLO829 Substitution: p.A3033I .
CORL23 Insertion: p.T1764_D1765insSPSSASTGDTTPLPVT
Substitution: p.T3942L		 .
DANG Substitution: p.D1461S; p.D3685N .
DAOY Deletion: p.A2446_T2468del .
DETROIT562 Substitution: p.A998T; p.R3974A DBIA    Probe Info 
DOTC24510 Deletion: p.S2661_T2708del
Substitution: p.T3910L		 DBIA    Probe Info 
DU145 SNV: p.T659A;p.G4878D
Substitution: p.M1535T		 .
ECC2 Deletion: p.D2979_P3010del
SNV: p.L1410H
Substitution: p.A4086T		 .
EGI1 Substitution: p.E2741_T2742delinsDA .
FADU Deletion: p.M1327_T1390del;p.P2978_L3025del
Substitution: p.D2757S;p.T3942L		 .
FUOV1 Substitution: p.T3942L; p.A4086T .
G361 Deletion: p.D3916GfsTer27
SNV: p.S534F;p.V1571G		 .
G402 Deletion: p.D2979_P3010del .
G415 SNV: p.R884S .
GAMG Deletion: p.D2979_P3010del
SNV: p.T2491S
Substitution: p.T3942L		 .
GB1 SNV: p.S1496A .
HCC1143 Substitution: p.S1669D .
HCC1187 Substitution: p.T3942L .
HCC1419 Insertion: p.T1684_G1685insSTFSASTGHATPLPVTDNSSVSTGHATPLPVT
Substitution: p.H1453_T1454delinsQA;p.D1461S;p.D3685N		 .
HCC15 Substitution: p.D2115V; p.S3248P; p.S3541D; p.L3542T .
HCC1806 Substitution: p.H1298T; p.V3742T .
HCC1937 Deletion: p.D2979_P3010del .
HCC1954 Substitution: p.H1453_T1454delinsQA; p.D1461S .
HCC44 Substitution: p.A998T .
HCT116 SNV: p.D4914N .
HCT15 SNV: p.T661N;p.S1482Y
Substitution: p.A998T;p.T3942L		 .
HDMYZ Deletion: p.S2661_T2692del; p.V3305_S3336del .
HEC1 SNV: p.L1410H
Substitution: p.S3941D;p.A4086T		 .
HEC1B SNV: p.A969T
Substitution: p.T3910L		 .
HEL Substitution: p.F4515N .
HEL9217 Deletion: p.S2661_T2708del
Substitution: p.F4515N		 .
HEPG2 SNV: p.F480V
Substitution: p.A4086T		 .
HG3 SNV: p.V2947A .
HKGZCC SNV: p.L1410H
Substitution: p.A4086T		 .
HL60 Substitution: p.V2825A .
HLF SNV: p.L1410H .
HSC3 Deletion: p.S2661_T2708del
Substitution: p.T3942L		 .
HSC4 Substitution: p.A3481L .
HT115 Substitution: p.S4181D .
HT1197 Deletion: p.V3305_S3336del .
HT1376 Deletion: p.S2661_T2708del
SNV: p.S1080Ter		 .
HT29 Insertion: p.T1684_G1685insSTFSASTGHATPLPVTDNSSVSTGHATPLPVT;p.T3710RfsTer550;p.T3710SfsTer111
Substitution: p.D3685N		 .
HUH28 Substitution: p.S1669D .
HUPT3 Deletion: p.D2979_P3010del; p.V3305_S3336del .
HUPT4 Substitution: p.A4086T DBIA    Probe Info 
ICC10 SNV: p.L1410H
Substitution: p.T3910L		 .
ICC106 SNV: p.L1410H .
ICC108 Deletion: p.V3305_S3336del
Insertion: p.H3933DfsTer327
SNV: p.L1410H		 .
ICC12 Deletion: p.S2661_T2692del DBIA    Probe Info 
ICC137 Deletion: p.G275EfsTer23
Insertion: p.H3421delinsQATPLPVTD		 .
ICC3 Insertion: p.G3564_Q3565insHATPLPVTDTSSASTGDTTPLPVTDASSASTG .
ICC4 Deletion: p.D2979_P3010del;p.G3564RfsTer18
SNV: p.L1410H
Substitution: p.T3942L;p.A4086T		 .
ICC9 Deletion: p.E2741_T2742delinsA
Substitution: p.V2825A		 .
IGROV1 SNV: p.G1500S
Substitution: p.A998T		 .
IM95 Deletion: p.D2979_P3010del; p.N4902TfsTer8 .
IPC298 SNV: p.P124S
Substitution: p.E2741_T2742delinsDA		 .
Ishikawa (Heraklio) 02 ER Substitution: p.S1669D; p.S3541D; p.L3542T .
J82 Deletion: p.D2979_P3010del
Substitution: p.S3941D		 .
JHH6 Deletion: p.S2661_T2692del;p.D2979_P3010del
SNV: p.L1410H;p.T2436S		 .
JHH7 SNV: p.P2838L .
KARPAS422 Deletion: p.D3957RfsTer66;p.G3980AfsTer270
SNV: p.L1410H
Substitution: p.E2741_T2742delinsDA		 .
KASUMI1 Deletion: p.D3957RfsTer66 .
KATOIII SNV: p.R4302G .
KMRC3 Substitution: p.A998T .
KNS42 Deletion: p.D2979_P3010del .
KPL1 SNV: p.L1410H
Substitution: p.T3942L		 .
KPNYN Deletion: p.V4003_P4098del .
KU1919 Substitution: p.A4086T; p.A4201V .
KURAMOCHI SNV: p.L1410H .
KYM1 Substitution: p.S2055F; p.P3312S; p.S3541D; p.L3542T .
KYSE150 Substitution: p.E2741_T2742delinsDA DBIA    Probe Info 
KYSE180 Substitution: p.P3392F .
KYSE30 SNV: p.G5059D .
KYSE410 Substitution: p.R3616S; p.A4086T .
KYSE510 Deletion: p.V3305_S3336del DBIA    Probe Info 
L428 SNV: p.S2872T .
LN229 Substitution: p.A3033I .
LS123 Substitution: p.V3993S DBIA    Probe Info 
LS180 SNV: p.F4386L .
LS513 Substitution: p.T3942L .
MCC13 Deletion: p.G3980VfsTer279
SNV: p.G519E;p.L1410H;p.P1858S;p.P4688L		 .
MCC26 Deletion: p.P3554_L3585del
SNV: p.S1482F		 .
MCF7 Substitution: p.S1669D; p.A4086T .
MDAMB157 Substitution: p.D1461S; p.D2005S; p.S2245D; p.A3033I .
MDAMB231 Substitution: p.A998T; p.S1669D .
MDAMB468 Substitution: p.P1504S; p.I2837D; p.V3305S .
MDST8 SNV: p.S1415F .
MELJUSO Deletion: p.D2979_P3010del;p.V3305_S3336del
Substitution: p.E2741_T2742delinsDA;p.A4086T;p.S4181D		 .
MEWO Substitution: p.G1740N; p.E2741_T2742delinsDA .
MFE280 Substitution: p.P2070V .
MFE296 Insertion: p.L3857SfsTer5
SNV: p.G1644C
Substitution: p.S3541D;p.L3542T		 .
MFE319 Deletion: p.A2446_T2468del .
MIAPACA2 Insertion: p.T1684_G1685insSTFSASTGHATPLPVTDNSSVSTGHATPLPVT
Substitution: p.E2741_T2742delinsDA;p.D3685N		 .
MKN1 Substitution: p.S3541D; p.L3542T; p.A4086T .
MKN45 SNV: p.D1533A .
MM1S Substitution: p.T3990L .
MOLM16 SNV: p.R5239C
Substitution: p.H3709_T3710delinsQA		 .
MOLT4 Deletion: p.A2822TfsTer151;p.V3305_S3336del
SNV: p.E5075G
Substitution: p.I3017A		 .
MSTO211H Insertion: p.T1684_G1685insSTFSASTGHATPLPVTDNSSVSTGHATPLPVT .
MV411 Substitution: p.D3685N .
NCIH1048 Substitution: p.E2741_T2742delinsDA; p.S3749D; p.A4086T .
NCIH1155 Substitution: p.V2825A .
NCIH146 Substitution: p.A998T .
NCIH1650 SNV: p.T3935P
Substitution: p.D3685N		 .
NCIH1666 Substitution: p.A4086T .
NCIH1703 Substitution: p.T3942L .
NCIH1792 Substitution: p.D3685N; p.T3942L .
NCIH1793 Deletion: p.M1327_T1390del
Substitution: p.A998T;p.M1535T		 .
NCIH196 SNV: p.L4559F
Substitution: p.A4086T		 .
NCIH1975 Insertion: p.H3421delinsQATPLPVTD
Substitution: p.E2149_T2150delinsDP;p.D3685N		 DBIA    Probe Info 
NCIH1993 SNV: p.A5096D
Substitution: p.E2741_T2742delinsDA		 .
NCIH2122 Substitution: p.R3616S .
NCIH2172 SNV: p.I942M .
NCIH23 Substitution: p.P2070V; p.V2825A .
NCIH716 Deletion: p.A2782_H2797del
SNV: p.A5096D		 .
NCIH82 Deletion: p.P1890LfsTer1114 .
NCIN87 Deletion: p.D2261_T2292del .
NOMO1 Substitution: p.A4086T .
NUGC3 Deletion: p.D2979_P3010del
Substitution: p.M1535T;p.S1669D		 .
OAW28 Deletion: p.D2261_T2292del
Substitution: p.P2070V		 .
OAW42 Substitution: p.V2825A .
OCUG1 Substitution: p.D3685N .
OCUM1 Deletion: p.G3564RfsTer18
Substitution: p.S1669D;p.T3942L		 .
ONS76 Substitution: p.A4086T .
OPM2 Substitution: p.T3942L .
OV56 Substitution: p.P3312S .
OVCAR8 Substitution: p.A998T; p.T3942L .
OVK18 Deletion: p.A3326PfsTer14
SNV: p.A577G
Substitution: p.A998T;p.A4086T		 .
OVKATE SNV: p.S2759F .
OZ Deletion: p.D2979_P3010del
SNV: p.L1410H
Substitution: p.A4086T		 .
P31FUJ Substitution: p.A4086T .
PANC1 Deletion: p.S3477_G3500del
SNV: p.V4009L		 .
PATU8988T Substitution: p.A4086T .
PC3 Substitution: p.M1327T; p.E2741_T2742delinsDA; p.V2825A .
PC9 SNV: p.P2946T .
PF382 Insertion: p.S4005RfsTer41
SNV: p.G963A;p.L1410H
Substitution: p.T3942L		 .
PFSK1 Deletion: p.V3331EfsTer9 .
RAMOS Insertion: p.T1951_P1952insSLPVTDASSVSTGHATSLPVTIPSSASSGHTT
Substitution: p.D3685N		 .
RD Substitution: p.E2741_T2742delinsDA .
REC1 Substitution: p.P3312S; p.D3957S .
RH30 Deletion: p.A2782_H2797del .
RH41 SNV: p.L1410H
Substitution: p.A3481L		 .
RKO Insertion: p.T1679_P1680insALPVTSTSSASTGHATPLPVTDNSSVSTGHAT
SNV: p.G4326R;p.T4772K
Substitution: p.D1461S;p.D3461S;p.D3685N;p.T3990L		 .
RL Deletion: p.A2782_H2797del .
RL952 Substitution: p.S1669D; p.S4181D .
RPMI7951 Substitution: p.V2825A .
RPMI8226 SNV: p.H2077P
Substitution: p.D1461S;p.V3305S		 .
RT112 Substitution: p.T3942L .
RVH421 SNV: p.P3138S
Substitution: p.S3029D;p.A3033I;p.D3685N		 .
SBC5 Substitution: p.P2070V .
SCC25 SNV: p.M4299T .
SG231 Deletion: p.D2979_P3010del
Substitution: p.A4086T		 .
SH4 Deletion: p.A2782_H2797del .
SHSY5Y Deletion: p.A2782_H2797del
Substitution: p.S3749D		 .
SISO Deletion: p.D2979_P3010del .
SJSA1 Substitution: p.V3305S; p.D3461S .
SKHEP1 SNV: p.D5284E
Substitution: p.P3312S;p.D3685N;p.D3957S		 .
SKMEL2 SNV: p.T3012I .
SKMEL24 Substitution: p.A998T .
SKMEL28 Substitution: p.E2741_T2742delinsDA; p.P3952T .
SKMEL3 Substitution: p.E2741_T2742delinsDA; p.V2825A .
SKMEL30 Deletion: p.A2782_H2797del
Substitution: p.L1641A;p.P3312S;p.D3685N;p.D3957S		 .
SKMEL5 Deletion: p.D2979_P3010del
Substitution: p.S1669D		 .
SKMM2 SNV: p.P1378H
Substitution: p.A4086T		 .
SKN Deletion: p.D2979_P3010del;p.A3977SfsTer60
Substitution: p.A4086T		 .
SKNAS Substitution: p.A998T; p.L3542T .
SKOV3 Substitution: p.V2825A; p.A3033I .
SNGM Insertion: p.S4955LfsTer9 .
SNU1 Substitution: p.A998T; p.S3749D .
SNU308 SNV: p.S4136Ter .
SNU449 Substitution: p.A998T .
SNU478 Substitution: p.A998T DBIA    Probe Info 
SNU869 Substitution: p.H3709_T3710delinsQA .
SSP25 Deletion: p.D2979_P3010del
SNV: p.L1410H		 .
SUDHL6 Substitution: p.H3709_T3710delinsQA .
SUIT2 Deletion: p.S3093_T3124del
Insertion: p.L2785_H2786insPVTNTSSASTGHATPL
Substitution: p.A998T		 .
SUPT1 SNV: p.S4039P .
SW1116 SNV: p.V5285A
Substitution: p.V2825A		 DBIA    Probe Info 
SW1573 Substitution: p.S4181D .
SW1990 Substitution: p.S1669D .
SW403 Deletion: p.S1397LfsTer46;p.V3305_S3336del
Insertion: p.P1398RfsTer89
SNV: p.P1378H;p.C4673Y		 .
SW480 Insertion: p.H3421delinsQATPLPVTD .
SW620 Insertion: p.H3421delinsQATPLPVTD .
SW756 SNV: p.L1921F; p.S2904Ter .
T24 Deletion: p.A2782_H2797del .
T98G SNV: p.P1378H .
TCCSUP Deletion: p.D3957RfsTer66 .
TE1 Substitution: p.A3033I .
TE10 Deletion: p.V3305_S3336del .
TE4 Deletion: p.S2661_T2692del .
TE8 SNV: p.L1410H .
TGBC1TKB Deletion: p.D2979_P3010del
SNV: p.L1410H
Substitution: p.T3942L		 .
TGBC52TKB Substitution: p.E2741_T2742delinsDA .
THP1 Substitution: p.A998T; p.T3942L; p.A4086T .
TKKK Insertion: p.T1951_P1952insSLPVTDASSVSTGHATSLPVTIPSSASSGHTT .
TOV21G SNV: p.S2375Y .
U118MG Substitution: p.E2741_T2742delinsDA .
U2OS Substitution: p.S3008L .
UACC257 Substitution: p.A4086T .
UACC62 Substitution: p.A4086T .
UMUC3 Deletion: p.P2978_L3025del
Substitution: p.A4086T		 .
WM2664 Substitution: p.A4086T .
YSCCC Deletion: p.D3949_G3964del
Substitution: p.E2741_T2742delinsDA		 .
ZR751 Substitution: p.T3942L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C325(2.42)  LDD3319  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 BICR-22 C325(1.91)  LDD2266  [1]
 LDCM0023  KB03 BxPC-3 C325(6.09)  LDD2697  [1]
 LDCM0024  KB05 MEWO C325(2.42)  LDD3319  [1]

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840