Details of the Target

General Information of Target

Target ID LDTP10789
Target Name Hemicentin-1 (HMCN1)
Gene Name HMCN1
Gene ID 83872
Synonyms
FIBL6; Hemicentin-1; Fibulin-6; FIBL-6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYL
SPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCK
VFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREE
EAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALS
DKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQ
FCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPE
YQEDSDISSFFC
Target Bioclass
Immunoglobulin
Subcellular location
Secreted, extracellular space, extracellular matrix, basement membrane
Function
Involved in transforming growth factor beta-mediated rearrangement of the podocyte cytoskeleton which includes reduction of F-actin fibers and broadening, flattening and elongation of podocytes. Plays a role in basement membrane organization. May promote cleavage furrow maturation during cytokinesis in preimplantation embryos. May play a role in the architecture of adhesive and flexible epithelial cell junctions. May play a role during myocardial remodeling by imparting an effect on cardiac fibroblast migration.
Uniprot ID
Q96RW7
Ensemble ID
ENST00000271588.9
HGNC ID
HGNC:19194

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
42MGBA SNV: p.P2900R .
ABC1 SNV: p.I260T .
AN3CA Deletion: p.G3718AfsTer6
SNV: p.T406K;p.I1120V		 .
AU565 SNV: p.E4445Ter .
BICR22 Substitution: p.T5004F .
CAL120 Substitution: p.T5004F .
CAL33 Substitution: p.H2009N .
CALU1 SNV: p.A2803V .
CCK81 SNV: p.D3573G .
CHL1 SNV: p.A2704V DBIA    Probe Info 
CORL88 SNV: p.P1856T .
DANG SNV: p.E798Ter .
DU145 SNV: p.T4164I .
HCT15 SNV: p.L329P; p.G1320D; p.G4776W; p.R4837Q .
HEC1 SNV: p.P2964L .
HGC27 SNV: p.V221G; p.P2805S .
HKGZCC SNV: p.P5361Q .
HL60 Substitution: p.T5004F .
HS936T SNV: p.P1289S .
HSC4 SNV: p.D764H .
HT1080 SNV: p.Q760R .
HT115 SNV: p.R76I; p.K203T; p.K926N; p.D3890G; p.F5624C .
JHH7 SNV: p.E478Ter .
JURKAT SNV: p.Q4044Ter .
KMCH1 SNV: p.A2259S; p.I4096M .
KMS11 SNV: p.D3460N; p.L3725I .
KNS81FD SNV: p.A4143G .
KYM1 SNV: p.G1973Ter .
KYSE30 SNV: p.H3617N .
LN18 SNV: p.E4502Ter; p.T5567K .
LNCaP clone FGC SNV: p.E4412Ter; p.N4807S .
LS513 SNV: p.S580G .
MDAMB453 SNV: p.E3073Q .
MEC1 Substitution: p.T5004F .
MFE319 SNV: p.G664C; p.I2622N; p.I4883V .
MOLT4 SNV: p.P5312S .
NB1 SNV: p.G5514W .
NCIH1048 SNV: p.A5546D .
NCIH1155 SNV: p.Q1601Ter .
NCIH1703 SNV: p.V309D; p.V2061F .
NCIH2172 SNV: p.H3388N .
NCIH2286 SNV: p.V3086L; p.I3806V; p.S5120R .
NCIH23 SNV: p.P3168T .
NCIH661 Deletion: p.H180IfsTer30
SNV: p.S1920G		 .
NCIH716 SNV: p.K1027T .
NUGC3 SNV: p.V1070E .
OAW42 Substitution: p.T5004F .
OE33 SNV: p.E3497D .
ONS76 SNV: p.F5104I .
RCC10RGB SNV: p.T1347I .
RKO Deletion: p.C5105VfsTer34 .
SHP77 SNV: p.E1139Q .
SKMEL30 SNV: p.P2131S .
SKNAS SNV: p.K2970E .
SNGM SNV: p.A2088V .
SSP25 SNV: p.V1637I .
SUDHL4 SNV: p.V1938L .
SUPT1 SNV: p.S4253G .
SW1573 SNV: p.S2063F .
SW756 SNV: p.G1491D .
T24 SNV: p.E5601K .
TC71 SNV: p.M4515L DBIA    Probe Info 
TKKK SNV: p.S4647R .
TYKNU SNV: p.G182A .
UMUC3 SNV: p.G2672W .
WM1552C SNV: p.M2020I .
ZR751 SNV: p.R325G .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C5283(1.64)  LDD3410  [1]
NAIA_5
 Probe Info  		N.A.  LDD2224  [2]
W1
 Probe Info  		N.A.  LDD0236  [3]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-1
 Probe Info  		N.A.  LDD0137  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A101D C1805(2.58); C5283(2.07); C4461(2.36); C2174(3.03)  LDD2250  [1]
 LDCM0023  KB03 A101D C1805(2.49); C5283(2.23); C4461(1.95); C2174(4.81)  LDD2667  [1]
 LDCM0024  KB05 RPMI-7951 C5283(1.64)  LDD3410  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Age-related maculopathy susceptibility protein 2 (ARMS2) . P0C7Q2

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
3 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
4 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.