General Information of Target

Target ID LDTP10761
Target Name Bile acid receptor (NR1H4)
Gene Name NR1H4
Gene ID 9971
Synonyms
BAR; FXR; HRR1; RIP14; Bile acid receptor; Farnesoid X-activated receptor; Farnesol receptor HRR-1; Nuclear receptor subfamily 1 group H member 4; Retinoid X receptor-interacting protein 14; RXR-interacting protein 14
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDT
LELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAA
ADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVH
PLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVLCHDALPLDAQASH
WQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSP
GDTVASKASAEGGSRGMGTHSSLLQ
Target Type
Successful
Target Bioclass
Transcription factor
Family
Nuclear hormone receptor family, NR1 subfamily
Subcellular location
Nucleus
Function
Ligand-activated transcription factor. Receptor for bile acids (BAs) such as chenodeoxycholic acid (CDCA), lithocholic acid, deoxycholic acid (DCA) and allocholic acid (ACA). Plays a essential role in BA homeostasis through the regulation of genes involved in BA synthesis, conjugation and enterohepatic circulation. Also regulates lipid and glucose homeostasis and is involved innate immune response. The FXR-RXR heterodimer binds predominantly to farnesoid X receptor response elements (FXREs) containing two inverted repeats of the consensus sequence 5'-AGGTCA-3' in which the monomers are spaced by 1 nucleotide (IR-1) but also to tandem repeat DR1 sites with lower affinity, and can be activated by either FXR or RXR-specific ligands. It is proposed that monomeric nuclear receptors such as NR5A2/LRH-1 bound to coregulatory nuclear responsive element (NRE) halfsites located in close proximity to FXREs modulate transcriptional activity. In the liver activates transcription of the corepressor NR0B2 thereby indirectly inhibiting CYP7A1 and CYP8B1 (involved in BA synthesis) implicating at least in part histone demethylase KDM1A resulting in epigenomic repression, and SLC10A1/NTCP (involved in hepatic uptake of conjugated BAs). Activates transcription of the repressor MAFG (involved in regulation of BA synthesis). Activates transcription of SLC27A5/BACS and BAAT (involved in BA conjugation), ABCB11/BSEP (involved in bile salt export) by directly recruiting histone methyltransferase CARM1, and ABCC2/MRP2 (involved in secretion of conjugated BAs) and ABCB4 (involved in secretion of phosphatidylcholine in the small intestine). Activates transcription of SLC27A5/BACS and BAAT (involved in BA conjugation), ABCB11/BSEP (involved in bile salt export) by directly recruiting histone methyltransferase CARM1, and ABCC2/MRP2 (involved in secretion of conjugated BAs) and ABCB4 (involved in secretion of phosphatidylcholine in the small intestine). In the intestine activates FGF19 expression and secretion leading to hepatic CYP7A1 repression. The function also involves the coordinated induction of hepatic KLB/beta-klotho expression. Regulates transcription of liver UGT2B4 and SULT2A1 involved in BA detoxification; binding to the UGT2B4 promoter seems to imply a monomeric transactivation independent of RXRA. Modulates lipid homeostasis by activating liver NR0B2/SHP-mediated repression of SREBF1 (involved in de novo lipogenesis), expression of PLTP (involved in HDL formation), SCARB1 (involved in HDL hepatic uptake), APOE, APOC1, APOC4, PPARA (involved in beta-oxidation of fatty acids), VLDLR and SDC1 (involved in the hepatic uptake of LDL and IDL remnants), and inhibiting expression of MTTP (involved in VLDL assembly. Increases expression of APOC2 (promoting lipoprotein lipase activity implicated in triglyceride clearance). Transrepresses APOA1 involving a monomeric competition with NR2A1 for binding to a DR1 element. Also reduces triglyceride clearance by inhibiting expression of ANGPTL3 and APOC3 (both involved in inhibition of lipoprotein lipase). Involved in glucose homeostasis by modulating hepatic gluconeogenesis through activation of NR0B2/SHP-mediated repression of respective genes. Modulates glycogen synthesis (inducing phosphorylation of glycogen synthase kinase-3). Modulates glucose-stimulated insulin secretion and is involved in insulin resistance. Involved in intestinal innate immunity. Plays a role in protecting the distal small intestine against bacterial overgrowth and preservation of the epithelial barrier. Down-regulates inflammatory cytokine expression in several types of immune cells including macrophages and mononuclear cells. Mediates trans-repression of TLR4-induced cytokine expression; the function seems to require its sumoylation and prevents N-CoR nuclear receptor corepressor clearance from target genes such as IL1B and NOS2. Involved in the TLR9-mediated protective mechanism in intestinal inflammation. Plays an anti-inflammatory role in liver inflammation; proposed to inhibit pro-inflammatory (but not antiapoptotic) NF-kappa-B signaling).; [Isoform 1]: Promotes transcriptional activation of target genes NR0B2/SHP (inducible by unconjugated CDCA), SLC51B/OSTB (inducible by unconjugated CDCA and DCA) and FABP6/IBAP; low activity for ABCB11/BSEP (inducible by unconjugated CDCA, DCA and ACA); not inducible by taurine- and glycine-amidated CDCA.; [Isoform 2]: Promotes transcriptional activation of target genes ABCB11/BSEP (inducible by unconjugated CDCA, DCA and ACA), NR0B2/SHP (inducible by unconjugated CDCA DCA and ACA), SLC51B/OSTB (inducible by unconjugated CDCA and DCA) and FABP6/IBAP; not inducible by taurine- and glycine-amidated CDCA.; [Isoform 3]: Promotes transcriptional activation of target genes NR0B2/SHP (inducible by unconjugated CDCA), SLC51B/OSTB (inducible by unconjugated CDCA and DCA) and IBAP; low activity for ABCB11/BSEP (inducible by unconjugated CDCA, DCA and ACA); not inducible by taurine- and glycine-amidated CDCA.; [Isoform 4]: Promotes transcriptional activation of target genes ABCB11/BSEP (inducible by unconjugated CDCA, ACA and DCA), NR0B2/SHP (inducible by unconjugated CDCA, ACA and DCA), SLC51B/OSTB (inducible by unconjugated CDCA and DCA) and FABP6/IBAP; most efficient isoform compared to isoforms 1 to 3; not inducible by taurine- and glycine-amidated CDCA.
TTD ID
T51426
Uniprot ID
Q96RI1
DrugMap ID
TTS4UGC
Ensemble ID
ENST00000188403.7
HGNC ID
HGNC:7967
ChEMBL ID
CHEMBL2047

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.K217N .
HT115 SNV: p.R177K .
Ishikawa (Heraklio) 02 ER SNV: p.Y46C .
KYSE150 SNV: p.R335H .
L428 SNV: p.Y198C .
NCIH2172 Deletion: p.V236Ter
SNV: p.Q98H
.
SNU1196 SNV: p.N24S .
SW948 SNV: p.K307Q .
U2OS SNV: p.I392S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info 
D427(0.00); E423(0.00)  LDD0447  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone-lysine N-methyltransferase SETD7 (SETD7) Histone-lysine methyltransferase family Q8WTS6
DNA-dependent protein kinase catalytic subunit (PRKDC) PI3/PI4-kinase family P78527
Nuclear receptor coactivator 1 (NCOA1) SRC/p160 nuclear receptor coactivator family Q15788
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Retinoic acid receptor RXR-beta (RXRB) Nuclear hormone receptor family P28702
Retinoic acid receptor RXR-gamma (RXRG) Nuclear hormone receptor family P48443
Estrogen receptor (ESR1) Nuclear hormone receptor family P03372

The Drug(s) Related To This Target

Approved
Click To Hide/Show 11 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Alpha-linolenic Acid Small molecular drug DB00132
Chenodeoxycholic Acid Small molecular drug DB06777
Chenodiol Small molecular drug D03ZTE
Cholic Acid Small molecular drug DB02659
Deoxycholic Acid Small molecular drug DB03619
Guggulsterone Small molecular drug D0G8BV
Obeticholic Acid Small molecular drug D0M4WA
Obeticholic Acid Small molecular drug DB05990
Taurocholic Acid Small molecular drug DB04348
Ursodeoxycholic Acid Small molecular drug DB01586
Myrrh . DB11605
Phase 3
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Bevacizumab + Trastuzumab Combination drug (Antibody) D04SLF
Gs-9674 Small molecular drug DBND71
Phase 2
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Apomine Small molecular drug D00HTO
Edp-305 Small molecular drug DM4K9V
Eyp001 Small molecular drug DBU2W3
Lmb763 Small molecular drug DW9ML8
Met409 Small molecular drug DX56JK
Ljn452 . D05EUR
Phase 1
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Agn-242266 Small molecular drug D4PV0B
Px-102 Small molecular drug D7LQJ8
Turofexorate Isopropyl Small molecular drug D01SYU
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Int-767 Small molecular drug DNZ96J
Investigative
Click To Hide/Show 13 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
12-o-deacetyl-12-epi-19-deoxy-21-hydroxyscalarin Small molecular drug D01GUG
22r-hydroxycholesterol Small molecular drug D0K4GK
Agn-34 Small molecular drug D0GR9O
Arachidonic Acid Small molecular drug DB04557
Cholesten Small molecular drug D0HH9N
Desmosterol Small molecular drug D01RNA
Farnesol Small molecular drug DB02509
Fexaramine Small molecular drug D01MYO
(8alpha10alpha13alpha17beta)-17-[(4-hydroxyphenyl)Carbonyl]Androsta-35-diene-3-carboxylic Acid . DB08220
1,1-bisphosphonate Esters . D0X4YY
Gw4065 . D0IO8G
Nidufexor . DB16255
Tropifexor . DB16343
Patented
Click To Hide/Show 45 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid29649907-compound-1 Small molecular drug D0WA9U
Pmid29649907-compound-10 Small molecular drug D0HR8Y
Pmid29649907-compound-11 Small molecular drug D0U0CC
Pmid29649907-compound-12 Small molecular drug D08ZAW
Pmid29649907-compound-13 Small molecular drug D0BN9E
Pmid29649907-compound-14 Small molecular drug D07NTP
Pmid29649907-compound-15 Small molecular drug D01QNX
Pmid29649907-compound-18 Small molecular drug D0F2OO
Pmid29649907-compound-19 Small molecular drug D0J4CL
Pmid29649907-compound-2 Small molecular drug D0F3SQ
Pmid29649907-compound-20 Small molecular drug D03IMJ
Pmid29649907-compound-21 Small molecular drug D0FC0B
Pmid29649907-compound-22 Small molecular drug D01XIW
Pmid29649907-compound-23 Small molecular drug D0TL4F
Pmid29649907-compound-24 Small molecular drug D08MBD
Pmid29649907-compound-25 Small molecular drug D0A4LL
Pmid29649907-compound-26 Small molecular drug D02OJH
Pmid29649907-compound-27 Small molecular drug D04QBY
Pmid29649907-compound-28 Small molecular drug D0OM2M
Pmid29649907-compound-29 Small molecular drug D07EDS
Pmid29649907-compound-3 Small molecular drug D0EB7G
Pmid29649907-compound-30 Small molecular drug D0ZG3D
Pmid29649907-compound-31 Small molecular drug D08MYA
Pmid29649907-compound-32 Small molecular drug D0UW8Q
Pmid29649907-compound-33 Small molecular drug D0F5MF
Pmid29649907-compound-34 Small molecular drug D0Z0FP
Pmid29649907-compound-35 Small molecular drug D0RL3M
Pmid29649907-compound-36 Small molecular drug D0N4PL
Pmid29649907-compound-37 Small molecular drug D0YK9Q
Pmid29649907-compound-38 Small molecular drug D0WT7M
Pmid29649907-compound-39 Small molecular drug D0K3UO
Pmid29649907-compound-4 Small molecular drug D0JD0G
Pmid29649907-compound-40 Small molecular drug D0Y0LI
Pmid29649907-compound-41 Small molecular drug D02RCY
Pmid29649907-compound-42 Small molecular drug D0Y3NZ
Pmid29649907-compound-44 Small molecular drug D0KB4T
Pmid29649907-compound-5 Small molecular drug D0E5ED
Pmid29649907-compound-8 Small molecular drug D0AA3P
Pmid29649907-compound-9 Small molecular drug D05QJY
Pmid29649907-compound-int767 Small molecular drug D08LIB
Pmid30259754-compound-int-767 Small molecular drug D0E0MH
Pmid30259754-compound-ly2562175 Small molecular drug D0TH6M
Pmid30259754-compound-px-102 Small molecular drug D0R8GK
Pmid30259754-compound-pyrrole[2,3-d]Azepines Small molecular drug D09FOM
Pmid30259754-compound-way-362450 Small molecular drug D03DZQ
Discontinued
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Sb-756050 . D03LFR
Skf-97426 . D08TKV

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.