Details of the Target
General Information of Target
| Target ID | LDTP10710 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine protease FAM111A (FAM111A) | |||||
| Gene Name | FAM111A | |||||
| Gene ID | 63901 | |||||
| Synonyms |
KIAA1895; Serine protease FAM111A; EC 3.4.21.- |
|||||
| 3D Structure | ||||||
| Sequence |
MEMTEMTGVSLKRGALVVEDNDSGVPVEETKKQKLSECSLTKGQDGLQNDFLSISEDVPR
PPDTVSTGKGGKNSEAQLEDEEEEEEDGLSEECEEEESESFADMMKHGLTEADVGITKFV SSHQGFSGILKERYSDFVVHEIGKDGRISHLNDLSIPVDEEDPSEDIFTVLTAEEKQRLE ELQLFKNKETSVAIEVIEDTKEKRTIIHQAIKSLFPGLETKTEDREGKKYIVAYHAAGKK ALANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYLRVKPNIFSYMGTKDKRAITV QEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLRNITGTDDQVQ QAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVK CREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGMKNIVSAFGIIPRNNRLMYIHSYQ SYVWNNMVSKRIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVMPLPGFDVIYPK HKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFN TDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQLNTTWL R |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
FAM111 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Single-stranded DNA-binding serine protease that mediates the proteolytic cleavage of covalent DNA-protein cross-links (DPCs) during DNA synthesis, thereby playing a key role in maintaining genomic integrity. DPCs are highly toxic DNA lesions that interfere with essential chromatin transactions, such as replication and transcription, and which are induced by reactive agents, such as UV light or formaldehyde. Protects replication fork from stalling by removing DPCs, such as covalently trapped topoisomerase 1 (TOP1) adducts on DNA lesion, or poly(ADP-ribose) polymerase 1 (PARP1)-DNA complexes trapped by PARP inhibitors. Required for PCNA loading on replication sites. Promotes S-phase entry and DNA synthesis. Acts also as a restriction factor for some viruses including SV40 polyomavirus and vaccinia virus. Mechanistically, affects nuclear barrier function during viral replication by mediating the disruption of the nuclear pore complex (NPC) via its protease activity. In turn, interacts with vaccinia virus DNA-binding protein OPG079 in the cytoplasm and promotes its degradation without the need of its protease activity but through autophagy.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C290(0.97) | LDD1700 | [1] | |
|
DBIA Probe Info |
![]() |
C36(44.59); C290(5.16) | LDD0209 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | 697 | C36(1.76); C212(1.40) | LDD2245 | [5] |
| LDCM0023 | KB03 | Jurkat | C36(44.59); C290(5.16) | LDD0209 | [2] |
| LDCM0024 | KB05 | COLO792 | C212(2.57) | LDD3310 | [5] |
| LDCM0497 | Nucleophilic fragment 11b | MDA-MB-231 | C290(0.98) | LDD2090 | [1] |
| LDCM0500 | Nucleophilic fragment 13a | MDA-MB-231 | C290(1.14) | LDD2093 | [1] |
| LDCM0515 | Nucleophilic fragment 20b | MDA-MB-231 | C290(0.72) | LDD2108 | [1] |
| LDCM0527 | Nucleophilic fragment 26b | MDA-MB-231 | C290(0.98) | LDD2120 | [1] |
| LDCM0532 | Nucleophilic fragment 29a | MDA-MB-231 | C290(0.74) | LDD2125 | [1] |
| LDCM0534 | Nucleophilic fragment 30a | MDA-MB-231 | C290(0.90) | LDD2127 | [1] |
| LDCM0542 | Nucleophilic fragment 37 | MDA-MB-231 | C290(1.09) | LDD2135 | [1] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C290(0.91) | LDD2136 | [1] |
| LDCM0211 | Nucleophilic fragment 3b | MDA-MB-231 | C290(0.97) | LDD1700 | [1] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C290(0.64) | LDD2141 | [1] |
| LDCM0550 | Nucleophilic fragment 5a | MDA-MB-231 | C290(2.49) | LDD2144 | [1] |
References




