General Information of Target

Target ID LDTP10691
Target Name Guanylate-binding protein 5 (GBP5)
Gene Name GBP5
Gene ID 115362
Synonyms
Guanylate-binding protein 5; EC 3.6.5.-; GBP-TA antigen; GTP-binding protein 5; GBP-5; Guanine nucleotide-binding protein 5
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLSISADCQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
Target Bioclass
Enzyme
Family
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3 GTPase family, GB1 subfamily
Subcellular location
Cytoplasmic vesicle membrane
Function
Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens. Hydrolyzes GTP, but in contrast to other family members, does not produce GMP. Following infection, recruited to the pathogen-containing vacuoles or vacuole-escaped bacteria and acts as a positive regulator of inflammasome assembly by promoting the release of inflammasome ligands from bacteria. Acts by promoting lysis of pathogen-containing vacuoles, releasing pathogens into the cytosol. Following pathogen release in the cytosol, promotes recruitment of proteins that mediate bacterial cytolysis: this liberates ligands that are detected by inflammasomes, such as lipopolysaccharide (LPS) that activates the non-canonical CASP4/CASP11 inflammasome or double-stranded DNA (dsDNA) that activates the AIM2 inflammasome. As an activator of NLRP3 inflammasome assembly: promotes selective NLRP3 inflammasome assembly in response to microbial and soluble, but not crystalline, agents. Independently of its GTPase activity, acts as an inhibitor of various viruses infectivity, such as HIV-1, Zika and influenza A viruses, by inhibiting FURIN-mediated maturation of viral envelope proteins.; Antigenic tumor-specific truncated splice form.
Uniprot ID
Q96PP8
Ensemble ID
ENST00000370459.8
HGNC ID
HGNC:19895

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HT SNV: p.E484G .
IM95 SNV: p.W88R .
JURKAT Deletion: p.K488del .
NCIH358 SNV: p.E321Ter .
OAW42 SNV: p.P582L .
RKO SNV: p.G186C .
SKMEL24 SNV: p.E381K .
SNU5 SNV: p.S273R .
TE4 SNV: p.S304I .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info 
C309(5.01)  LDD1703  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 T cell C309(5.01)  LDD1703  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Guanylate-binding protein 1 (GBP1) GB1/RHD3 GTPase family P32455
Guanylate-binding protein 2 (GBP2) GB1/RHD3 GTPase family P32456
Guanylate-binding protein 3 (GBP3) GB1/RHD3 GTPase family Q9H0R5
Guanylate-binding protein 4 (GBP4) GB1/RHD3 GTPase family Q96PP9
Guanylate-binding protein 5 (GBP5) GB1/RHD3 GTPase family Q96PP8

References

1 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.