Details of the Target
General Information of Target
Target ID | LDTP10675 | |||||
---|---|---|---|---|---|---|
Target Name | Adhesion G protein-coupled receptor A2 (ADGRA2) | |||||
Gene Name | ADGRA2 | |||||
Gene ID | 25960 | |||||
Synonyms |
GPR124; KIAA1531; TEM5; Adhesion G protein-coupled receptor A2; G-protein coupled receptor 124; Tumor endothelial marker 5 |
|||||
3D Structure | ||||||
Sequence |
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT MYMEALVKLFDKHKTKFGLPETEVLEVN |
|||||
Target Bioclass |
GPCR
|
|||||
Family |
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Endothelial receptor which functions together with RECK to enable brain endothelial cells to selectively respond to Wnt7 signals (WNT7A or WNT7B). Plays a key role in Wnt7-specific responses, such as endothelial cell sprouting and migration in the forebrain and neural tube, and establishment of the blood-brain barrier. Acts as a Wnt7-specific coactivator of canonical Wnt signaling: required to deliver RECK-bound Wnt7 to frizzled by assembling a higher-order RECK-ADGRA2-Fzd-LRP5-LRP6 complex. ADGRA2-tethering function does not rely on its G-protein coupled receptor (GPCR) structure but instead on its combined capacity to interact with RECK extracellularly and recruit the Dishevelled scaffolding protein intracellularly. Binds to the glycosaminoglycans heparin, heparin sulfate, chondroitin sulfate and dermatan sulfate.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C979(2.21) | LDD3423 | [1] | |
YN-1 Probe Info |
![]() |
N.A. | LDD0447 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References