Details of the Target

General Information of Target

Target ID LDTP10636
Target Name Protein GUCD1 (GUCD1)
Gene Name GUCD1
Gene ID 83606
Synonyms
C22orf13; LLN4; Protein GUCD1; Guanylyl cyclase domain-containing protein 1; Protein LLN4
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYA
SHMEPQVCLHASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQ
DPLNWFGILVPHSLRQAQASFRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA
Target Bioclass
Enzyme
Uniprot ID
Q96NT3
Ensemble ID
ENST00000398245.8
HGNC ID
HGNC:14237

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD0241  [1]
DBIA
 Probe Info  		C185(1.60)  LDD3339  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 BICR-22 C185(1.20)  LDD2266  [2]
 LDCM0023  KB03 A101D C185(2.09)  LDD2667  [2]
 LDCM0024  KB05 NALM-6 C185(1.60)  LDD3339  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Plasma alpha-L-fucosidase (FUCA2) Glycosyl hydrolase 29 family Q9BTY2
Mitochondrial inner membrane protease ATP23 homolog (ATP23) Peptidase M76 family Q9Y6H3
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Dual specificity mitogen-activated protein kinase kinase 5 (MAP2K5) STE Ser/Thr protein kinase family Q13163
Pterin-4-alpha-carbinolamine dehydratase 2 (PCBD2) Pterin-4-alpha-carbinolamine dehydratase family Q9H0N5
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
Cystathionine gamma-lyase (CTH) Trans-sulfuration enzymes family P32929
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase (NGLY1) PNGase family Q96IV0
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
Transcription factor
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox expressed in ES cells 1 (HESX1) ANF homeobox family Q9UBX0
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Zinc finger protein 705D (ZNF705D) Krueppel C2H2-type zinc-finger protein family P0CH99
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
Cone-rod homeobox protein (CRX) Paired homeobox family O43186
DNA-binding protein inhibitor ID-3 (ID3) . Q02535
Transcription factor 4 (TCF4) . P15884
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) G-protein coupled receptor 2 family Q03431
Other
Click To Hide/Show 39 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cancer/testis antigen 1 (CTAG1A; CTAG1B) CTAG/PCC1 family P78358
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Iron-sulfur cluster assembly 2 homolog, mitochondrial (ISCA2) HesB/IscA family Q86U28
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-5 (KRTAP1-5) KRTAP type 1 family Q9BYS1
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 3-2 (KRTAP3-2) KRTAP type 3 family Q9BYR7
Keratin-associated protein 3-3 (KRTAP3-3) KRTAP type 3 family Q9BYR6
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Keratin-associated protein 5-6 (KRTAP5-6) KRTAP type 5 family Q6L8G9
Keratin-associated protein 5-7 (KRTAP5-7) KRTAP type 5 family Q6L8G8
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Keratin-associated protein 9-8 (KRTAP9-8) KRTAP type 9 family Q9BYQ0
Late cornified envelope protein 1C (LCE1C) LCE family Q5T751
Late cornified envelope protein 2A (LCE2A) LCE family Q5TA79
Late cornified envelope protein 2B (LCE2B) LCE family O14633
Late cornified envelope protein 2D (LCE2D) LCE family Q5TA82
Keratin-associated protein 13-3 (KRTAP13-3) PMG family Q3SY46
Prefoldin subunit 5 (PFDN5) Prefoldin subunit alpha family Q99471
R-spondin-4 (RSPO4) R-spondin family Q2I0M5
Heat shock protein beta-7 (HSPB7) Small heat shock protein (HSP20) family Q9UBY9
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Tetraspanin-4 (TSPAN4) Tetraspanin (TM4SF) family O14817
Toll-interacting protein (TOLLIP) Tollip family Q9H0E2
Brain-enriched guanylate kinase-associated protein (BEGAIN) . Q9BUH8
Four and a half LIM domains protein 3 (FHL3) . Q13643
KATNB1-like protein 1 (KATNBL1) . Q9H079
Keratinocyte proline-rich protein (KPRP) . Q5T749
MORN repeat-containing protein 3 (MORN3) . Q6PF18
MORN repeat-containing protein 4 (MORN4) . Q8NDC4
Ras/Rap GTPase-activating protein SynGAP (SYNGAP1) . Q96PV0
Sperm mitochondrial-associated cysteine-rich protein (SMCP) . P49901
Vasorin (VASN) . Q6EMK4
Zinc finger CCHC domain-containing protein 13 (ZCCHC13) . Q8WW36

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840