Details of the Target
General Information of Target
| Target ID | LDTP10568 | |||||
|---|---|---|---|---|---|---|
| Target Name | (E2-independent) E3 ubiquitin-conjugating enzyme FATS (C10orf90) | |||||
| Gene Name | C10orf90 | |||||
| Gene ID | 118611 | |||||
| Synonyms |
FATS; (E2-independent) E3 ubiquitin-conjugating enzyme FATS; EC 2.3.2.-; Centrosomal protein C10orf90; E2/E3 hybrid ubiquitin-protein ligase FATS; Fragile-site associated tumor suppressor homolog; FATS
|
|||||
| 3D Structure | ||||||
| Sequence |
MPYSTNKELILGIMVGTAGISLLLLWYHKVRKPGIAMKLPEFLSLGNTFNSITLQDEIHD
DQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKI SPQHRARKRRLPTIQSSATSNSSEEAESEGGYITANTDTEEQSFPVPKAFNTRVEELNLD VLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKKHY ANIGKTLSERAINRAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLP EEPFLYYLKGRYCYTVSKLSWIEKKMAATLFGKIPSSTVQEALHNFLKAEELCPGYSNPN YMYLAKCYTDLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Tumor suppressor that is required to sustain G2/M checkpoint after DNA damage. Acts as a p53/TP53 activator by inhibiting MDM2 binding to p53/TP53 and stimulating non-proteolytic polyubiquitination of p53/TP53. Exhibits ubiquitin ligase (E3) activity and assemble ubiquitin polymers through 'Lys-11'- (K11-), 'Lys-29'- (K29-) and 'Lys-63'- (K63)-linkages, independently of the ubiquitin-conjugating enzyme (E2). Promotes p53/TP53-dependent transcription of CDKN1A/p21, leading to robust checkpoint response. Mediates CDKN1A/p21 protein stability in a ubiquitin-independent manner. Interacts with HDAC1 and prevents binding of HDAC1 to CDKN1A/p21 and facilitates the acetylation and stabilization of CDKN1A/p21. May have a role in the assembly of primary cilia (Probable).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C130(3.95) | LDD3430 | [1] | |
Competitor(s) Related to This Target

