Details of the Target
General Information of Target
| Target ID | LDTP10559 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sphingomyelin synthase-related protein 1 (SAMD8) | |||||
| Gene Name | SAMD8 | |||||
| Gene ID | 142891 | |||||
| Synonyms |
Sphingomyelin synthase-related protein 1; SMSr; EC 2.7.8.-; Ceramide phosphoethanolamine synthase; CPE synthase; Sterile alpha motif domain-containing protein 8; SAM domain-containing protein 8 |
|||||
| 3D Structure | ||||||
| Sequence |
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ YMTNRAEHDRMARQWTKRYAT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Sphingomyelin synthase family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Sphingomyelin synthases synthesize sphingolipids through transfer of a phosphatidyl head group on to the primary hydroxyl of ceramide. SAMD8 is an endoplasmic reticulum (ER) transferase that has no sphingomyelin synthase activity but can convert phosphatidylethanolamine (PE) and ceramide to ceramide phosphoethanolamine (CPE) albeit with low product yield. Appears to operate as a ceramide sensor to control ceramide homeostasis in the endoplasmic reticulum rather than a converter of ceramides. Seems to be critical for the integrity of the early secretory pathway.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0025 | [1] | |
|
PPMS Probe Info |
![]() |
N.A. | LDD0008 | [2] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [1] | |
|
VSF Probe Info |
![]() |
N.A. | LDD0007 | [2] | |
References




