Details of the Target
General Information of Target
| Target ID | LDTP10558 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubiquitin-conjugating enzyme E2 E2 (UBE2E2) | |||||
| Gene Name | UBE2E2 | |||||
| Gene ID | 7325 | |||||
| Synonyms |
UBCH8; Ubiquitin-conjugating enzyme E2 E2; EC 2.3.2.23; E2 ubiquitin-conjugating enzyme E2; UbcH8; Ubiquitin carrier protein E2; Ubiquitin-protein ligase E2 |
|||||
| 3D Structure | ||||||
| Sequence |
MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIM
ALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPG RSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGER ARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Ubiquitin-conjugating enzyme family
|
|||||
| Function |
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
13.71 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K52(4.48) | LDD0277 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0164 | [3] | |
|
NAIA_5 Probe Info |
![]() |
C75(0.00); C81(0.00) | LDD2224 | [4] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [5] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [5] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [6] | |
|
AOyne Probe Info |
![]() |
11.50 | LDD0443 | [7] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Arrestin domain-containing protein 3 (ARRDC3) | Arrestin family | Q96B67 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protein FAM9B (FAM9B) | FAM9 family | Q8IZU0 | |||
| CUE domain-containing protein 1 (CUEDC1) | . | Q9NWM3 | |||
| DAZ-associated protein 2 (DAZAP2) | . | Q15038 | |||
References








