Details of the Target

General Information of Target

Target ID LDTP10552
Target Name Centrosomal protein of 19 kDa (CEP19)
Gene Name CEP19
Gene ID 84984
Synonyms
C3orf34; Centrosomal protein of 19 kDa; Cep19
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGRTRPSLQKSQGVEVCA
HHIPSPPPAIPYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI
NRKNLEEEAVETVAKKASSLQLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKK
QGSSRAGNLEEPSDQEPRLLLAVRSPTGQRFVRHFRPTDDLQTIVAVAEQKNKTSYRHCS
IETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP
Target Bioclass
Other
Family
CEP19 family
Subcellular location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
Function
Required for ciliation. Recruits the RABL2B GTPase to the ciliary base to initiate ciliation. After specifically capturing the activated GTP-bound RABL2B, the CEP19-RABL2B complex binds intraflagellar transport (IFT) complex B from the large pool pre-docked at the base of the cilium and thus triggers its entry into the cilia. Involved in the early steps in cilia formation by recruiting the ciliary vesicles (CVs) to the distal end of the mother centriole where they fuse to initiate cilium assembly. Involved in microtubule (MT) anchoring to the centrosomes.
Uniprot ID
Q96LK0
Ensemble ID
ENST00000409690.5
HGNC ID
HGNC:28209

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C3(0.33)  LDD1702  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C3(0.33)  LDD1702  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transitional endoplasmic reticulum ATPase (VCP) AAA ATPase family P55072
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2) APS kinase family; Sulfate adenylyltransferase family O95340
Sentrin-specific protease 3 (SENP3) Peptidase C48 family Q9H4L4
Tyrosine-protein phosphatase non-receptor type 23 (PTPN23) Protein-tyrosine phosphatase family Q9H3S7
Guanine nucleotide-binding protein-like 3 (GNL3) TRAFAC class YlqF/YawG GTPase family Q9BVP2
E3 ubiquitin-protein ligase TRAIP (TRAIP) TRAIP family Q9BWF2
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Peroxisomal membrane protein PEX13 (PEX13) Peroxin-13 family Q92968
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) BZIP family Q68CJ9
Zinc finger and BTB domain-containing protein 14 (ZBTB14) Krueppel C2H2-type zinc-finger protein family O43829
Zinc finger protein 1 homolog (ZFP1) Krueppel C2H2-type zinc-finger protein family Q6P2D0
Zinc finger protein 438 (ZNF438) Krueppel C2H2-type zinc-finger protein family Q7Z4V0
Forkhead box protein R1 (FOXR1) . Q6PIV2
Glucocorticoid modulatory element-binding protein 2 (GMEB2) . Q9UKD1
Homeobox protein notochord (NOTO) . A8MTQ0
Proto-oncogene c-Rel (REL) . Q04864
Zinc finger protein 420 (ZNF420) . Q8TAQ5
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Roundabout homolog 4 (ROBO4) ROBO family Q8WZ75
Other
Click To Hide/Show 25 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Anaphase-promoting complex subunit 15 (ANAPC15) APC15 family P60006
Calcium-binding and coiled-coil domain-containing protein 1 (CALCOCO1) CALCOCO family Q9P1Z2
cAMP-dependent protein kinase type I-beta regulatory subunit (PRKAR1B) CAMP-dependent kinase regulatory chain family P31321
Centrosomal protein 43 (CEP43) CEP43 family O95684
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
KxDL motif-containing protein 1 (KXD1) KXD1 family Q9BQD3
Nesprin-4 (SYNE4) Nesprin family Q8N205
Testis-specific Y-encoded-like protein 2 (TSPYL2) Nucleosome assembly protein (NAP) family Q9H2G4
Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3) PI3K p85 subunit family Q92569
Heat shock protein beta-2 (HSPB2) Small heat shock protein (HSP20) family Q16082
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Troponin I, slow skeletal muscle (TNNI1) Troponin I family P19237
Golgi apparatus membrane protein TVP23 homolog B (TVP23B) TVP23 family Q9NYZ1
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Cerebellar degeneration-related antigen 1 (CDR1) . P51861
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 106 (CCDC106) . Q9BWC9
Coiled-coil domain-containing protein 74A (CCDC74A) . Q96AQ1
Ecotropic viral integration site 5 protein homolog (EVI5) . O60447
Pleckstrin homology domain-containing family O member 1 (PLEKHO1) . Q53GL0
PRKCA-binding protein (PICK1) . Q9NRD5
Proline-rich acidic protein 1 (PRAP1) . Q96NZ9
SERTA domain-containing protein 3 (SERTAD3) . Q9UJW9
Uncharacterized protein C4orf19 (C4orf19) . Q8IY42
Uncharacterized protein KIAA1958 (KIAA1958) . Q8N8K9

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761