Details of the Target
General Information of Target
| Target ID | LDTP10552 | |||||
|---|---|---|---|---|---|---|
| Target Name | Centrosomal protein of 19 kDa (CEP19) | |||||
| Gene Name | CEP19 | |||||
| Gene ID | 84984 | |||||
| Synonyms |
C3orf34; Centrosomal protein of 19 kDa; Cep19 |
|||||
| 3D Structure | ||||||
| Sequence |
MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGRTRPSLQKSQGVEVCA
HHIPSPPPAIPYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI NRKNLEEEAVETVAKKASSLQLSSIRALYQDETGTMKTSEEDSRARACAVERKFIVRTKK QGSSRAGNLEEPSDQEPRLLLAVRSPTGQRFVRHFRPTDDLQTIVAVAEQKNKTSYRHCS IETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CEP19 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
|
|||||
| Function |
Required for ciliation. Recruits the RABL2B GTPase to the ciliary base to initiate ciliation. After specifically capturing the activated GTP-bound RABL2B, the CEP19-RABL2B complex binds intraflagellar transport (IFT) complex B from the large pool pre-docked at the base of the cilium and thus triggers its entry into the cilia. Involved in the early steps in cilia formation by recruiting the ciliary vesicles (CVs) to the distal end of the mother centriole where they fuse to initiate cilium assembly. Involved in microtubule (MT) anchoring to the centrosomes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C3(0.33) | LDD1702 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Peroxisomal membrane protein PEX13 (PEX13) | Peroxin-13 family | Q92968 | |||
Transcription factor
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Roundabout homolog 4 (ROBO4) | ROBO family | Q8WZ75 | |||
Other

