Details of the Target
General Information of Target
| Target ID | LDTP10490 | |||||
|---|---|---|---|---|---|---|
| Target Name | Hematopoietic SH2 domain-containing protein (HSH2D) | |||||
| Gene Name | HSH2D | |||||
| Gene ID | 84941 | |||||
| Synonyms |
ALX; Hematopoietic SH2 domain-containing protein; Hematopoietic SH2 protein; Adaptor in lymphocytes of unknown function X |
|||||
| 3D Structure | ||||||
| Sequence |
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRS SYSSPTSLSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS SFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI QEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSSRA |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
May be a modulator of the apoptotic response through its ability to affect mitochondrial stability. Adapter protein involved in tyrosine kinase and CD28 signaling. Seems to affect CD28-mediated activation of the RE/AP element of the interleukin-2 promoter.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C269(1.46) | LDD0304 | [1] | |
|
DBIA Probe Info |
![]() |
C269(3.43); C299(3.46) | LDD3372 | [2] | |
|
IPIAA_L Probe Info |
![]() |
N.A. | LDD0031 | [3] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | EoL-1 | C68(1.96); C269(1.87); C299(1.64) | LDD2324 | [2] |
| LDCM0023 | KB03 | EoL-1 | C68(1.93); C269(2.00); C299(1.50) | LDD2741 | [2] |
| LDCM0024 | KB05 | OCI-Ly3 | C269(3.43); C299(3.46) | LDD3372 | [2] |
| LDCM0131 | RA190 | MM1.R | C269(1.46) | LDD0304 | [1] |
The Interaction Atlas With This Target
References




