Details of the Target
General Information of Target
| Target ID | LDTP10489 | |||||
|---|---|---|---|---|---|---|
| Target Name | PDZ and LIM domain protein 2 (PDLIM2) | |||||
| Gene Name | PDLIM2 | |||||
| Gene ID | 64236 | |||||
| Synonyms |
PDZ and LIM domain protein 2; PDZ-LIM protein mystique |
|||||
| 3D Structure | ||||||
| Sequence |
MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMARE
WRAAQGKDPGPSEKQKPVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNI FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASEIRQDL QLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK KIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFN SSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY MSQKDGYKSFSSLS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Nucleus; Cytoplasm, cytoskeleton
|
|||||
| Function |
Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| COLO678 | SNV: p.P10A | DBIA Probe Info | |||
| PF382 | SNV: p.Y111Ter | DBIA Probe Info | |||
| SW756 | SNV: p.V298M | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K31(4.78) | LDD0277 | [1] | |
|
IPM Probe Info |
![]() |
C289(0.00); C160(0.00) | LDD0241 | [2] | |
|
DBIA Probe Info |
![]() |
C539(1.61) | LDD3311 | [3] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [4] | |
|
IA-alkyne Probe Info |
![]() |
C289(0.00); C334(0.00) | LDD2241 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [5] | |
|
NAIA_5 Probe Info |
![]() |
C286(0.00); C289(0.00); C334(0.00) | LDD2223 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References








