Details of the Target

General Information of Target

Target ID LDTP10479
Target Name Coiled-coil domain-containing protein 136 (CCDC136)
Gene Name CCDC136
Gene ID 64753
Synonyms
KIAA1793; Coiled-coil domain-containing protein 136; Nasopharyngeal carcinoma-associated gene 6 protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMAD
QDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYR
PDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGL
QNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQD
GKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQS
RKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISV
VMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQ
GEAAQSANESKNE
Target Bioclass
Other
Subcellular location
Cytoplasmic vesicle, secretory vesicle, acrosome membrane
Function May play a role in acrosome formation in spermatogenesis and in fertilization.
Uniprot ID
Q96JN2
Ensemble ID
ENST00000297788.9
HGNC ID
HGNC:22225

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CASKI SNV: p.E847G .
HCC1143 SNV: p.L857V .
HCC1395 SNV: p.S1103C .
HCT15 SNV: p.C321W .
HEC1 SNV: p.S1026N .
Ishikawa (Heraklio) 02 ER SNV: p.E583G .
MCC13 SNV: p.S1104F .
MFE319 Insertion: p.Y378IfsTer2 .
NCIH146 SNV: p.E838Ter .
NCIH2291 SNV: p.Q632K .
NCIH358 SNV: p.L611M .
SKMEL2 Insertion: p.V999GfsTer10 .
SNU1 SNV: p.P1108L .
TOV21G SNV: p.L1105I .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD2156  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone deacetylase 4 (HDAC4) Histone deacetylase family P56524
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
26S proteasome non-ATPase regulatory subunit 9 (PSMD9) Proteasome subunit p27 family O00233
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Ras-related protein Rab-33A (RAB33A) Rab family Q14088
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase subunit O, mitochondrial (ATP5PO) ATPase delta chain family P48047
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Transcription factor
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 230 (ZNF230) Krueppel C2H2-type zinc-finger protein family Q9UIE0
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 490 (ZNF490) Krueppel C2H2-type zinc-finger protein family Q9ULM2
Zinc finger protein 564 (ZNF564) Krueppel C2H2-type zinc-finger protein family Q8TBZ8
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
High mobility group protein 20A (HMG20A) . Q9NP66
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related (HMG20B) . Q9P0W2
Zinc finger and SCAN domain-containing protein 26 (ZSCAN26) . Q16670
Zinc finger protein 581 (ZNF581) . Q9P0T4
Other
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ankyrin repeat and SOCS box protein 7 (ASB7) Ankyrin SOCS box (ASB) family Q9H672
Biogenesis of lysosome-related organelles complex 1 subunit 6 (BLOC1S6) BLOC1S6 family Q9UL45
Bystin (BYSL) Bystin family Q13895
Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) CDK2AP family O14519
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Activator of basal transcription 1 (ABT1) ESF2/ABP1 family Q9ULW3
Protein FAM161A (FAM161A) FAM161 family Q3B820
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL) SHFL family Q9NUL5
Alpha-taxilin (TXLNA) Taxilin family P40222
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Centrosomal protein CEP57L1 (CEP57L1) Translokin family Q8IYX8
Troponin T, slow skeletal muscle (TNNT1) Troponin T family P13805
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Zinc finger C2HC domain-containing protein 1C (ZC2HC1C) ZC2HC1 family Q53FD0
Chromobox protein homolog 8 (CBX8) . Q9HC52
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
KAT8 regulatory NSL complex subunit 1 (KANSL1) . Q7Z3B3
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Melanoma-associated antigen B4 (MAGEB4) . O15481
PDZ and LIM domain protein 5 (PDLIM5) . Q96HC4
Phostensin (PPP1R18) . Q6NYC8

References

1 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019