Details of the Target
General Information of Target
| Target ID | LDTP10422 | |||||
|---|---|---|---|---|---|---|
| Target Name | Terminal nucleotidyltransferase 5A (TENT5A) | |||||
| Gene Name | TENT5A | |||||
| Gene ID | 55603 | |||||
| Synonyms |
C6orf37; FAM46A; XTP11; Terminal nucleotidyltransferase 5A; EC 2.7.7.19; HBV X-transactivated gene 11 protein; HBV XAg-transactivated protein 11 |
|||||
| 3D Structure | ||||||
| Sequence |
MLPCAAGARGRGAMVVLRAGKKTFLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCP
PRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSK EKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFA ITFFMGKVALERIWNKLKQKQKKRSN |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TENT family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Cytoplasmic non-canonical poly(A) RNA polymerase that catalyzes the transfer of one adenosine molecule from an ATP to an mRNA poly(A) tail bearing a 3'-OH terminal group and participates in the cytoplasmic polyadenylation. Polyadenylates mRNA encoding extracellular matrix constituents and other genes crucial for bone mineralization and during osteoblast mineralization, mainly focuses on ER-targeted mRNAs.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C214(3.10) | LDD3332 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [2] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [2] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [2] |
| LDCM0022 | KB02 | A204 | C316(2.47) | LDD2252 | [1] |
| LDCM0023 | KB03 | A204 | C214(3.42); C316(5.69) | LDD2669 | [1] |
| LDCM0024 | KB05 | MKN45 | C214(3.10) | LDD3332 | [1] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0224 | [2] |
The Interaction Atlas With This Target
References



